ACADVL

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
ACADVL
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2UXW, 3B96

Identifikatori
AliasiACADVL
Vanjski ID-jeviOMIM: 609575 MGI: 895149 HomoloGene: 5 GeneCards: ACADVL
Lokacija gena (čovjek)
Hromosom 17 (čovjek)
Hrom.Hromosom 17 (čovjek)[1]
Hromosom 17 (čovjek)
Genomska lokacija za ACADVL
Genomska lokacija za ACADVL
Bend17p13.1Početak7,217,125 bp[1]
Kraj7,225,266 bp[1]
Lokacija gena (miš)
Hromosom 11 (miš)
Hrom.Hromosom 11 (miš)[2]
Hromosom 11 (miš)
Genomska lokacija za ACADVL
Genomska lokacija za ACADVL
Bend11 B3|11 42.96 cMPočetak70,010,183 bp[2]
Kraj70,015,411 bp[2]
Ontologija gena
Molekularna funkcija oxidoreductase activity, acting on the CH-CH group of donors
acyl-CoA dehydrogenase activity
oxidoreductase activity
flavin adenine dinucleotide binding
long-chain-acyl-CoA dehydrogenase activity
fatty-acyl-CoA binding
very-long-chain-acyl-CoA dehydrogenase activity
Ćelijska komponenta membrana
mitochondrial matrix
Jedarce
mitohondrija
mitochondrial inner membrane
mitochondrial nucleoid
Jedro
citosol
mitochondrial membrane
Biološki proces epithelial cell differentiation
negative regulation of fatty acid biosynthetic process
lipid metabolism
negative regulation of fatty acid oxidation
energy derivation by oxidation of organic compounds
fatty acid metabolic process
regulation of cholesterol metabolic process
IRE1-mediated unfolded protein response
fatty acid beta-oxidation
temperature homeostasis
fatty acid catabolic process
response to cold
fatty acid beta-oxidation using acyl-CoA dehydrogenase
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_000018
NM_001033859
NM_001270447
NM_001270448

NM_017366

RefSeq (bjelančevina)

NP_000009
NP_001029031
NP_001257376
NP_001257377

NP_059062

Lokacija (UCSC)Chr 17: 7.22 – 7.23 MbChr 11: 70.01 – 70.02 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Mitohondrijska specifična acil-CoA dehidrogenaza vrlo dugog lanca (VLCAD) je enzim koji kod ljudi kodira genom ACADV.

Mutacije u ACADVL povezane su sa nedostatkom acil-koenzima A dehidrogenaze vrlo dugog lanca. Protein koji kodira ovaj gen usmjeren je na unutrašnju mitohondrijsku membranu, gdje katalizira prvi korak beta-oksidacijskog puta mitohondrijske masne kiseline. Ova acil-koenzim A dehidrogenaza specifična je za dugolančane i vrlo dugolančane masne kiseline. Nedostatak ovog genskog proizvoda smanjuje beta-oksidaciju masnih kiselina miokarda i povezan je sa kardiomiopatijom. Alternativna prerada rezultira u više varijanti transkripta koji kodiraju različite izoforme.[5]

Struktura[uredi | uredi izvor]

Dužina polipeptidnog lanca je 655 aminokiselina, a molekulska težina 70.390 Da.[6]

Aminokiselinska sekvenca

1020304050
MQAARMAASLGRQLLRLGGGSSRLTALLGQPRPGPARRPYAGGAAQLALD
KSDSHPSDALTRKKPAKAESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQ
FLKELVEPVSRFFEEVNDPAKNDALEMVEETTWQGLKELGAFGLQVPSEL
GGVGLCNTQYARLVEIVGMHDLGVGITLGAHQSIGFKGILLFGTKAQKEK
YLPKLASGETVAAFCLTEPSSGSDAASIRTSAVPSPCGKYYTLNGSKLWI
SNGGLADIFTVFAKTPVTDPATGAVKEKITAFVVERGFGGITHGPPEKKM
GIKASNTAEVFFDGVRVPSENVLGEVGSGFKVAMHILNNGRFGMAAALAG
TMRGIIAKAVDHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMV
SANMDQGATDFQIEAAISKIFGSEAAWKVTDECIQIMGGMGFMKEPGVER
VLRDLRIFRIFEGTNDILRLFVALQGCMDKGKELSGLGSALKNPFGNAGL
LLGEAGKQLRRRAGLGSGLSLSGLVHPELSRSGELAVRALEQFATVVEAK
LIKHKKGIVNEQFLLQRLADGAIDLYAMVVVLSRASRSLSEGHPTAQHEK
MLCDTWCIEAAARIREGMAALQSDPWQQELYRNFKSISKALVERGGVVTS
NPLGF
Simboli

Gen ACADVL sadrži 20 egzona,[7] i dug je oko 5,4 kb.[8] VLCAD ima zanimljivu gensku strukturu kod ljudi, koja se nalazi u strukturi glave do glave sa genom DLG4 na hromosomu 17, i da se transkribirani regioni ovih gena preklapaju. Pokazano je da tretman sa DEHP rezultira regulacijom minimalnim promotorom.[9] While DLG4 and VLCAD share common regulatory elements, they each have separate and distinct tissue-specific elements that confer their function. In mice, these two genes are in a head-to-head orientation, but they do not overlap.[8]

Funkcija[uredi | uredi izvor]

VLCAD enzim katalizira većinu beta-oksidacije masnih kiselina, stvarajući C2-C3 trans-dvostruku vezu u masnoj kiselini. Specifičan je za masne kiseline vrlo dugog lanca, obično C16-acylCoA i duže.[10] Miševi koji imaju nedostatak VLCAD, imaju malo ili nimalo hiperacetilacije proteina u jetri; to implicira da je protein VLCAD također neophodan za acetilaciju proteina u ovom biološkom sistemu.[11]

Klinički značaj[uredi | uredi izvor]

ACADVL je povezan sa nedostatakom acil-koenzima dugolančane A dehidrogenaze (VLCADD), koji ima mnogo simptoma, i obično se ispoljava kao jedan od tri fenotipa. Prvi je težak, sa ranim djetinjstvenom i visokom stopom smrtnosti; najčešći simptom ovog oblika je kardiomiopatija. Drugi je sa kasnim početkom dječjeg oblika, s blažim simptomima koji se najčešće javljaju kao hipoketonska hipoglikemija. Konačni oblik se pojavljuje u odrasloj dobi i uljučuje izolirano zahvatanje skeletnih mišića, rabdomiolizu i mioglobinuriju, što je izazvano vježbanjem ili postom.[12] Bolest se obično dijagnosticira tako što se prvo izvrši tandemska masena spektrometrija na uzorku krvi pacijenta tokom perioda stresa, a zatim se izvrši molekulskoo genetičko testiranje na prisustvo gena ACADVL. Nedostatak se sistematski liječi, ali se izbjegavaju određena stanja kao što su post, iritacija miokarda, dehidracija i dijeta s visokim udjelom masti, u pokušaju sprječavanja sekundarnih komplikacija.[13]

Interakcije[uredi | uredi izvor]

Pokazalo se da ACADVL ima 75 binarnih interakcije protein-protein, uključujući 73 kompleksne interakcije. Čini se da ACADVL komunicira sa RPSA i GPHN.[14]

Također pogledajte[uredi | uredi izvor]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000072778 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000018574 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "acyl-CoA dehydrogenase, very long chain".
  6. ^ "UniProt, P49748". Pristupljeno 16. 6. 2021.
  7. ^ Strauss AW, Powell CK, Hale DE, Anderson MM, Ahuja A, Brackett JC, Sims HF (Nov 1995). "Molecular basis of human mitochondrial very-long-chain acyl-CoA dehydrogenase deficiency causing cardiomyopathy and sudden death in childhood". Proceedings of the National Academy of Sciences of the United States of America. 92 (23): 10496–500. doi:10.1073/pnas.92.23.10496. PMC 40638. PMID 7479827.
  8. ^ a b Zhou C, Blumberg B (Feb 2003). "Overlapping gene structure of human VLCAD and DLG4". Gene. 305 (2): 161–6. doi:10.1016/s0378-1119(02)01235-0. PMID 12609736.
  9. ^ Zhang LF, Ding JH, Yang BZ, He GC, Roe C (Dec 2003). "Characterization of the bidirectional promoter region between the human genes encoding VLCAD and PSD-95". Genomics. 82 (6): 660–8. doi:10.1016/s0888-7543(03)00211-8. PMID 14611808.
  10. ^ Aoyama T, Souri M, Ushikubo S, Kamijo T, Yamaguchi S, Kelley RI, Rhead WJ, Uetake K, Tanaka K, Hashimoto T (Jun 1995). "Purification of human very-long-chain acyl-coenzyme A dehydrogenase and characterization of its deficiency in seven patients". The Journal of Clinical Investigation. 95 (6): 2465–73. doi:10.1172/JCI117947. PMC 295925. PMID 7769092.
  11. ^ Pougovkina O, te Brinke H, Ofman R, van Cruchten AG, Kulik W, Wanders RJ, Houten SM, de Boer VC (Jul 2014). "Mitochondrial protein acetylation is driven by acetyl-CoA from fatty acid oxidation". Human Molecular Genetics. 23 (13): 3513–22. doi:10.1093/hmg/ddu059. PMID 24516071.
  12. ^ Andresen BS, Olpin S, Poorthuis BJ, Scholte HR, Vianey-Saban C, Wanders R, Ijlst L, Morris A, Pourfarzam M, Bartlett K, Baumgartner ER, deKlerk JB, Schroeder LD, Corydon TJ, Lund H, Winter V, Bross P, Bolund L, Gregersen N (Feb 1999). "Clear correlation of genotype with disease phenotype in very-long-chain acyl-CoA dehydrogenase deficiency". American Journal of Human Genetics. 64 (2): 479–94. doi:10.1086/302261. PMC 1377757. PMID 9973285.
  13. ^ Leslie, N. D.; Valencia, C. A.; Strauss, A. W.; Zhang, K.; Adam, M. P.; Ardinger, H. H.; Pagon, R. A.; Wallace, S. E.; Bean LJH; Stephens, K.; Amemiya, A. (1993). "Very Long-Chain Acyl-Coenzyme a Dehydrogenase Deficiency". PMID 20301763. journal zahtijeva |journal= (pomoć)
  14. ^ "75 binary interactions found for search term ACADVL". IntAct Molecular Interaction Database. EMBL-EBI. Pristupljeno 24. 8. 2018.

Dopunska literatura[uredi | uredi izvor]

  • Costa CG, Dorland L, de Almeida IT, Jakobs C, Duran M, Poll-The BT (juni 1998). "The effect of fasting, long-chain triglyceride load and carnitine load on plasma long-chain acylcarnitine levels in mitochondrial very long-chain acyl-CoA dehydrogenase deficiency". Journal of Inherited Metabolic Disease. 21 (4): 391–9. doi:10.1023/A:1005354624735. PMID 9700596. S2CID 2198523.

Vanjski linkovi[uredi | uredi izvor]

Šablon:Enzimi lipidnog metabolizma