ACSBG2

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
ACSBG2
Identifikatori
AliasiACSBG2
Vanjski ID-jeviOMIM: 614363 MGI: 3587728 HomoloGene: 57133 GeneCards: ACSBG2
Lokacija gena (čovjek)
Hromosom 19 (čovjek)
Hrom.Hromosom 19 (čovjek)[1]
Hromosom 19 (čovjek)
Genomska lokacija za ACSBG2
Genomska lokacija za ACSBG2
Bend19p13.3Početak6,135,247 bp[1]
Kraj6,193,094 bp[1]
Lokacija gena (miš)
Hromosom 17 (miš)
Hrom.Hromosom 17 (miš)[2]
Hromosom 17 (miš)
Genomska lokacija za ACSBG2
Genomska lokacija za ACSBG2
Bend17|17 DPočetak56,843,103 bp[2]
Kraj56,874,447 bp[2]
Obrazac RNK ekspresije
PBB GE ACSBG2 221716 s at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija long-chain fatty acid-CoA ligase activity
nucleotide binding
acyl-CoA hydrolase activity
ligase activity
ATP binding
catalytic activity
very long-chain fatty acid-CoA ligase activity
decanoate-CoA ligase activity
Ćelijska komponenta citoplazma
mitohondrija
membrana
citosol
Biološki proces multicellular organism development
Ćelijska diferencijacija
metabolizam
long-chain fatty-acyl-CoA biosynthetic process
Spermatogeneza
fatty acid metabolic process
lipid metabolism
long-chain fatty acid metabolic process
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)
NM_001289177
NM_001289178
NM_001289179
NM_001289180
NM_030924

NM_001321384

NM_001039114

RefSeq (bjelančevina)
NP_001276106
NP_001276107
NP_001276108
NP_001276109
NP_001308313

NP_112186

NP_001034203

Lokacija (UCSC)Chr 19: 6.14 – 6.19 MbChr 17: 56.84 – 56.87 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

CoA ligaza ACSBG2 dugolančane masne kiseline je enzim koji je kod ljudi kodiran genom ACSBG2.[5][6]

Aminokiselinski sastav kodiranog proteina[uredi | uredi izvor]

Simboli
1020304050
MTGTPKTQEGAKDLEVDMNKTEVTPRLWTTCRDGEVLLRLSKHGPGHETP
MTIPEFFRESVNRFGTYPALASKNGKKWEILNFNQYYEACRKAAKSLIKL
GLERFHGVGILGFNSAEWFITAVGAILAGGLCVGIYATNSAEVCQYVITH
AKVNILLVENDQQLQKILSIPQSSLEPLKAIIQYRLPMKKNNNLYSWDDF
MELGRSIPDTQLEQVIESQKANQCAVLIYTSGTTGIPKGVMLSHDNITWI
AGAVTKDFKLTDKHETVVSYLPLSHIAAQMMDIWVPIKIGALTYFAQADA
LKGTLVSTLKEVKPTVFIGVPQIWEKIHEMVKKNSAKSMGLKKKAFVWAR
NIGFKVNSKKMLGKYNTPVSYRMAKTLVFSKVKTSLGLDHCHSFISGTAP
LNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCK
NMLFQQNKDGIGEICLWGRHIFMGYLESETETTEAIDDEGWLHSGDLGQL
DGLGFLYVTGHIKEILITAGGENVPPIPVETLVKKKIPIISNAMLVGDKL
KFLSMLLTLKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQD
PLVYKAIQQGINAVNQEAMNNAQRIEKWVILEKDFSIYGGELGPMMKLKR
HFVAQKYKKQIDHMYH

Kloniranje i ekspresija[uredi | uredi izvor]

Profiliranjem ekspresije za identifikaciju gena različito eksprimiranih između testisa fetusa i odraslog čovjeka, nakon čega slijedi analiza baze podataka, Zheng et al. (2005) identificirali su šest alternativno prerađenih varijanti ACSBG2. Varijante se uglavnom razlikuju u preradi prvih sedam egzona, s tim da su u većini varijanti uključeni egzoni 8 do 16. Protein pune dužine, koji je kodiran u tri prerađene varijante, sadrži 666 aminokiselina. RT-PCR korištenjem prajmera smještenih u zajedničkom području šest varijanti otkrivena je ekspresija ACSBG2 u testisima, gušterači, srcu, plućima, jetri, bubrezima, tankom i debelom crijevu. Koristeći specifične prajmere RT-PCR pokazano je da je jedna varijanta, koja kodira protein od 479 aminokiselina, posebno eksprimirana u testisima, kao i u ljudskim Leydigovim ćelijama. Ekspresija ovog transkripta bila je 50 puta veća u testisima odraslih nego u embriona. Pretragom baza podataka za sekvence slične ACSBG1 (614362), nakon čega slijedi PCR biblioteka cDNK testisa, Pei et al. (2006) klonirali su ACSBG2. Izvedeni protein od 666 aminokiselina ima izračunatu molekulsku masu od 74,4 kD i dijeli 50% identiteta sa ACSBG1. ACSBG2 sadrži domen koja veže AMP, drugu konzerviranu regiju u acetil-CoA sintetazama, dva potencijalna mjesta N-glikozilacije i potencijalni transmembranski domen. AMP-vezujući domen ACSBG2 ima histidin (his511), umjesto visoko konzerviranog arginina koji se nalazi u drugim acetil-CoA sintetazama. Pacovski i mišji ACSBG1, koji sadrže po 667 aminokiselina, takođe imaju arginin na homolognom položaju u domenu koji veže AMP. Tačkasta analiza ljudskih tkiva pokazala je ekspresiju ACSBG1 samo u testisima. Analiza Southern i Western blota miševa otkrila je iRNK i protein ACSBG2 u testisima, meduli i kičmenoj moždini.

Hibridizacija in situ mišjeg testisa pokazala je ekspresiju Acsbg2 uglavnom u Sertolijevim ćelijama. Histohemijskim ispitivanjem moždanog stabla i kičmene moždine miša otkrivena je lokalizacija Acsbg2 u velikim motornim neuronima medulske mrežaste formacije i podjezičnog jezgra, u nekim motornim neuronima u prednjem i stražnjem rogu vratne i u nekoliko ćelija grudne kičmene moždine. Western blot analiza frakcionisanog mišjeg testisa otkrila je Acsbg2 uglavnom u mikrosomskoj frakciji, s tim da je neki Acsbg2 bio u citosolu. Ekspresija mišjeg ili humanog ACSBG2 u staničnim linijama rezultirala je pretežno citoplazmatskim proteinom.

Funkcija gena[uredi | uredi izvor]

Koristeći RT-PCR, Zheng et al. (2005) pokazali su da je ekspresija varijante ACSBG2specifične za testis smanjena u testisima neplodnih muškaraca sa sindromom samo Sertolijevih ćelija ili drugim oblicima azoospermije.[7]

Koristeći biohemijsku analizu in vitro, Pei et al. (2006) pokazali su da je ACSBG2 eksprimiran u COS-1 ćelijama koristio oleinsku (C18: 1, omega-9) i linolnu kiselinu (C18: 2, omega-6) kao supstrate za sintezu acil-CoA. Nije otkrivena značajnija aktivnost kod ostalih testiranih podloga. ACSBG2 pokazao je pH optimum od pH 6,5, sa nižim sekundarnim maksimumima pri pH 7,5. Dobivena mutacija his511 na arg je monofazni pH optimum, između pH 7,0 i 7,5, sličan onome koji je pokazao divlji tip miša Acsbg2, bez promjene u preferenciji supstrata. Pei et al. (2006) zaključili su da ljudska specifična supstitucija arg511 sa njegovom utiče na katalitsku efikasnost enzima[8][9]

Zheng et al. (2005) utvrdili su da gen ACSBG2 sadrži 16 egzona i obuhvata 57,4 kb.[10]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000130377 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000024207 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Böcher M, Blöcker H, Bauersachs S, Blum H, Lauber J, Düsterhöft A, Beyer A, Köhrer K, Strack N, Mewes HW, Ottenwälder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A (Mar 2001). "Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs". Genome Research. 11 (3): 422–35. doi:10.1101/gr.GR1547R. PMC 311072. PMID 11230166.
  6. ^ "Entrez Gene: ACSBG2 acyl-CoA synthetase bubblegum family member 2".
  7. ^ Zheng, Y., Zhou, Z.-M., Min, X., Li, J.-M., Sha, J.-H. Identification and characterization of the BGR-like gene with a potential role in human testicular development/spermatogenesis. Asian J. Androl. 7: 21-32, 2005. PubMed: 15685348
  8. ^ Pei, Z., Jia, Z., Watkins, P. A. The second member of the human and murine 'bubblegum' family is a testis- and brainstem-specific acyl-CoA synthetase. J. Biol. Chem. 281: 6632-6641, 2006. [PubMed: 16371355
  9. ^ Watkins, P. A., Maiguel, D., Jia, Z., Pevsner, J. Evidence for 26 distinct acyl-coenzyme A synthetase genes in the human genome. J. Lipid Res. 48: 2736-2750, 2007. PubMed: 17762044
  10. ^ Pei Z, Jia Z, Watkins PA (Mar 2006). "The second member of the human and murine bubblegum family is a testis- and brainstem-specific acyl-CoA synthetase". The Journal of Biological Chemistry. 281 (10): 6632–41. doi:10.1074/jbc.M511558200. PMID 16371355.

Vanjski linkovi[uredi | uredi izvor]

Dopunska literatura[uredi | uredi izvor]