ARGLU1

S Wikipedije, slobodne enciklopedije
ARGLU1
Identifikatori
AliasiARGLU1
Vanjski ID-jeviOMIM: 614046 MGI: 2442985 HomoloGene: 9960 GeneCards: ARGLU1
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za ARGLU1
Genomska lokacija za ARGLU1
Bend13q33.3Početak106,541,673 bp[1]
Kraj106,568,137 bp[1]
Lokacija gena (miš)
Hromosom 8 (miš)
Hrom.Hromosom 8 (miš)[2]
Hromosom 8 (miš)
Genomska lokacija za ARGLU1
Genomska lokacija za ARGLU1
Bend8|8 A1.1Početak8,715,075 bp[2]
Kraj8,740,521 bp[2]
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 protein binding
cadherin binding
Ćelijska komponenta mitohondrija
Jedro
Nukleoplazma
Biološki proces GO:0009373 regulation of transcription, DNA-templated
transcription, DNA-templated
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_018011

NM_176849

RefSeq (bjelančevina)

NP_060481

NP_789819

Lokacija (UCSC)Chr 13: 106.54 – 106.57 MbChr 8: 8.72 – 8.74 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Argininom i glutamatom bogati protein 1 je protein koji je kod ljudi kodiran genom ARGLU1, lociranom na poziciji13q33.3.[5]

Proteinski proizvod ovog gena predložen je kao MED1-interakcijski protein potreban za estrogen-ovisnu transkripciju gena i rast ćelija raka dojke. [6]

Gen ARGLU1 eksprimira najmanje tri različite izoforme prerade RNK – potpuno prerađena izoforma koja kodira protein, izoforma koja sadrži zadržani intron, u jedru i izoforma koja sadrži alternativni egzon koji cilja transkript za nonsens propadanje. Nadalje, ARGLU1 sadrži dugu, evolucijski visoko konzerviranu sekvencu poznatu kao ultrakonzervirani element (UCE) koja se nalazi unutar zadržnog introna i preklapa alternativni egzon.[7]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 273 aminokiseline, a molekulska težina 33.216 Da.[8]

1020304050
MGRSRSRSSSRSKHTKSSKHNKKRSRSRSRSRDKERVRKRSKSRESKRNR
RRESRSRSRSTNTAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQK
REEEEKKAEFERQRKIRQQEIEEKLIEEETARRVEELVAKRVEEELEKRK
DEIEREVLRRVEEAKRIMEKQLLEELERQRQAELAAQKAREEEERAKREE
LERILEENNRKIAEAQAKLAEEQLRIVEEQRKIHEERMKLEQERQRQQKE
EQKIILGKGKSRPKLSFSLKTQD
Simboli

Kloniranje i ekspresija[uredi | uredi izvor]

Zhang et al. (2011) klonirano ljudsko ARGLU1. Izvedeni protein od 273 aminokiseline ima pozitivno nabijeni N-terminalni domen bogat argininom i negativno nabijen C-terminaln domen bogat glutamatom. Također ima nekoliko signala za jedarnu lokalizaciju. Imunohistohemijska analiza otkrila je da je ARGLU1 pretežno lokaliziran u jedru ćelija raka dojke MCF-7, gdje se kolokalizirao s podjedinicom kompleksa medijator-1 (MED1). Analiza baze podataka otkrila je ortologe ARGLU1 u rodu Drosophila i miševima, ali ne i u kvascu.[9]

Funkcija gena[uredi | uredi izvor]

Kompleks medijator je veliki proteinski kompleks, koji prenosi signale od transkripcijskih aktivatora do RNK- polimeraze II i općeg mehanizma za transkripciju. Kompleksi posrednika koji uključuju MED1 komuniciraju s estrogenim receptorima (ER ili ESR1) i posreduju u funkcijama ovisnim o estrogenu. Koristeći masenu spektrometriju, Zhang et al (2011) otkrili su da je ARGLU1 bio u interakciji s MED1, ali ne i s drugim podjedinicama medijatora. Analize imunoprecipitacije i povlačenja proteina potvrdile su njihovu direktnu interakciju. Analiza mutacije otkrila je da je za interakciju potrebna C-terminalna regija MED1 i N-terminalna regija ARGLU1. Ektopiijska ekspresija samog ARGLU1 povećala je aktivnost reportera ovisnu o estrogenu u ćelijama MCF-7, a koekspresija MED1 s ARGLU1 dodatno je povećala aktivnost reportera ovisnu o estrogenu. RNK kratke ukosnice usmjerena protiv ARGLU1 oslabila je estrogeno ovisnu indukciju ER ciljnih gena. Analiza imunoprecipitacije hromatina pokazala je da su i ARGLU1 i MED1 regrutirani kao kompleks za promotore ER ciljnih gena. Nokdaun studije pokazale su da je ARGLU1 potreban i za ovisnost o sidrištu i o nezavisnom rastu ćelija MCF-7. Pretpostavili su da ARGLU1 može imati regulatornu ulogu preko interakcije s kompleksima posrednika MED1.[9]

Magomedova et al. (2019) identificirali su evolucijski konzervirani gen ARGLU1 tokom pregleda za modulatore signalizacije glukokortikoida u CNS -u. Inhibicija ARGLU1 u neuronskim čelijama miša rezultirala je velikim promjenama u ekspresiji ili preradom drugih gena uključenih u neurogenezu. Nokaut kod zebrice uzrokovao je neurorazvoj i srčane greške, a homozigotnost za nokaut Arglu1 cijelog tijela bila je letalna za mišje embrione. Autori su zaključili da je ARGLU1 potreban za moduliranje bazne transkripcije i oreradu tokom embrionskog razvoja u neuronskim ćelijama.[10]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000134884 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000040459 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: ARGLU1 arginine and glutamate rich 1". CS1 održavanje: nepreporučeni parametar (link)
  6. ^ Zhang D, Jiang P, Xu Q, Zhang X (May 2011). "Arginine and glutamate-rich 1 (ARGLU1) interacts with mediator subunit 1 (MED1) and is required for estrogen receptor-mediated gene transcription and breast cancer cell growth". J. Biol. Chem. 286 (20): 17746–54. doi:10.1074/jbc.M110.206029. PMC 3093850. PMID 21454576.
  7. ^ Pirnie SP, Osman A, Zhu Y, Carmichael GG (April 2017). "An Ultraconserved Element (UCE) controls homeostatic splicing of ARGLU1 mRNA". Nucleic Acids Res. 45 (6): 3473–3486. doi:10.1093/nar/gkw1140. PMC 5389617. PMID 27899669.
  8. ^ "UniProt, Q9NWB6". Pristupljeno 2017-09-11. CS1 održavanje: nepreporučeni parametar (link)
  9. ^ a b Zhang, D., Jiang, P., Xu, Q., Zhang, X. Arginine and glutamate-rich 1 (ARGLU1) interacts with Mediator subunit 1 (MED1) and is required for estrogen receptor-mediated gene transcription and breast cancer cell growth. J. Biol. Chem. 286: 17746-17754, 2011. PubMed: 21454576
  10. ^ Magomedova, L., Tiefenbach, J., Zilberman, E., Le Billan, F., Voisin, V., Saikali, M., Boivin, V., Robitaille, M., Gueroussov, S., Irimia, M., Ray, D., Patel, R., and 10 others. ARGLU1 is a transcriptional coactivator and splicing regulator important for stress hormone signaling and development. Nucleic Acids Res. 47: 2856-2870, 2019. PubMed: 30698747

Vanjski linkovi[uredi | uredi izvor]