ARHGAP44

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
ARHGAP44
Identifikatori
AliasiARHGAP44
Vanjski ID-jeviOMIM: 617716 MGI: 2144423 HomoloGene: 65284 GeneCards: ARHGAP44
Lokacija gena (čovjek)
Hromosom 17 (čovjek)
Hrom.Hromosom 17 (čovjek)[1]
Hromosom 17 (čovjek)
Genomska lokacija za ARHGAP44
Genomska lokacija za ARHGAP44
Bend17p12Početak12,789,498 bp[1]
Kraj12,991,643 bp[1]
Lokacija gena (miš)
Hromosom 11 (miš)
Hrom.Hromosom 11 (miš)[2]
Hromosom 11 (miš)
Genomska lokacija za ARHGAP44
Genomska lokacija za ARHGAP44
Bend11|11 B3Početak65,002,039 bp[2]
Kraj65,162,961 bp[2]
Ontologija gena
Molekularna funkcija GO:0001948 protein binding
phospholipid binding
GO:0005097, GO:0005099, GO:0005100 GTPase activator activity
Ćelijska komponenta citoplazma
reciklirajući endosom
citosol
međućelijske veze
endozom
dendritična kičma
projekcija ćelije
sinapsa
leading edge membrane
glutamatergic synapse
intracellular anatomical structure
GO:0097483, GO:0097481 postsynaptic density
presynaptic active zone
Biološki proces GO:0032320, GO:0032321, GO:0032855, GO:0043089, GO:0032854 positive regulation of GTPase activity
regulation of small GTPase mediated signal transduction
signal transduction
Egzocitoza
regulation of actin cytoskeleton organization
GO:0043087, GO:0032313, GO:0032319, GO:0032314, GO:0043088 regulation of GTPase activity
regulation of dendritic spine morphogenesis
modification of dendritic spine
neurotransmitter receptor transport, endosome to postsynaptic membrane
negative regulation of Rac protein signal transduction
modification of postsynaptic structure
regulation of neurotransmitter receptor transport, endosome to postsynaptic membrane
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_014859
NM_001321164
NM_001321166
NM_001321167
NM_001321168

NM_001099288
NM_175003

RefSeq (bjelančevina)

NP_001308093
NP_001308095
NP_001308096
NP_001308097
NP_055674

NP_001092758
NP_778168

Lokacija (UCSC)Chr 17: 12.79 – 12.99 MbChr 11: 65 – 65.16 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Rho GTPazno aktivirajući protein 44 jest protein koji je kod ljudi kodiran genom ARHGAP44.[5]

Dužina polipeptidnog lanca je 818 aminokiselina, sa molekulskom težinom od 89.247.[6]

Aminokiselinska sekvenca

Simboli
1020304050
MKKQFNRMRQLANQTVGRAEKTEVLSEDLLQVEKRLELVKQVSHSTHKKL
TACLQGQQGAEADKRSKKLPLTTLAQCLMEGSAILGDDTLLGKMLKLCGE
TEDKLAQELIHFELQVERDVIEPLFLLAEVEIPNIQKQRKHLAKLVLDMD
SSRTRWQQTSKSSGLSSSLQPAGAKADALREEMEEAANRVEICRDQLSAD
MYSFVAKEIDYANYFQTLIEVQAEYHRKSLTLLQAVLPQIKAQQEAWVEK
PSFGKPLEEHLTISGREIAFPIEACVTMLLECGMQEEGLFRVAPSASKLK
KLKAALDCCVVDVQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQA
SNVQEQDKKLQALWNACEKLPKANHNNIRYLIKFLSKLSEYQDVNKMTPS
NMAIVLGPNLLWPQAEGNITEMMTTVSLQIVGIIEPIIQHADWFFPGEIE
FNITGNYGSPVHVNHNANYSSMPSPDMDPADRRQPEQARRPLSVATDNMM
LEFYKKDGLRKIQSMGVRVMDTNWVARRGSSAGRKVSCAPPSMQPPAPPA
ELAAPLPSPLPEQPLDSPAAPALSPSGLGLQPGPERTSTTKSKELSPGSA
QKGSPGSSQGTACAGTQPGAQPGAQPGASPSPSQPPADQSPHTLRKVSKK
LAPIPPKVPFGQPGAMADQSAGQPSPVSLSPTPPSTPSPYGLSYPQGYSL
ASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSA
SSPQSTEAPMLDGMSPGESMSTDLVHFDIPSIHIELGSTLRLSPLEHMRR
HSVTDKRDSEEESESTAL

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000006740 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000033389 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: Rho GTPase activating protein 44". Pristupljeno 13. 5. 2013.
  6. ^ "UniProt, Q17R89". Pristupljeno 12. 9. 2017.