ATP5PF

S Wikipedije, slobodne enciklopedije
ATP5PF
Identifikatori
AliasiATP5PF
Vanjski ID-jeviOMIM: 603152 MGI: 107777 HomoloGene: 1272 GeneCards: ATP5PF
Lokacija gena (čovjek)
Hromosom 21 (čovjek)
Hrom.Hromosom 21 (čovjek)[1]
Hromosom 21 (čovjek)
Genomska lokacija za ATP5PF
Genomska lokacija za ATP5PF
Bend21q21.3Početak25,716,503 bp[1]
Kraj25,735,673 bp[1]
Lokacija gena (miš)
Hromosom 16 (miš)
Hrom.Hromosom 16 (miš)[2]
Hromosom 16 (miš)
Genomska lokacija za ATP5PF
Genomska lokacija za ATP5PF
Bend16|16 C3.3Početak84,624,754 bp[2]
Kraj84,632,513 bp[2]
Obrazac RNK ekspresije
PBB GE ATP5J 202325 s at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija transporter activity
proton transmembrane transporter activity
GO:0022891 transmembrane transporter activity
ATPase activity
GO:0032403 protein-containing complex binding
Ćelijska komponenta mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)
proton-transporting ATP synthase complex, coupling factor F(o)
membrana
mitochondrial proton-transporting ATP synthase complex
mitochondrial inner membrane
mitohondrija
Vanćelijsko
cell surface
Biološki proces ATP synthesis coupled proton transport
ion transport
substantia nigra development
ATP metabolic process
mitochondrial ATP synthesis coupled proton transport
ATP biosynthetic process
cristae formation
GO:0015915 transport
positive regulation of heart rate
response to muscle activity
negative regulation of prostaglandin secretion
positive regulation of blood pressure
negative regulation of arachidonic acid secretion
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)
NM_001003696
NM_001003697
NM_001003701
NM_001003703
NM_001685

NM_001320266
NM_001320267

NM_016755
NM_001302213
NM_001302214
NM_001302215
NM_001302216

NM_001358499
NM_001358500

RefSeq (bjelančevina)
NP_001003696
NP_001003697
NP_001003701
NP_001003703
NP_001307195

NP_001307196
NP_001676

NP_001289142
NP_001289143
NP_001289144
NP_001289145
NP_058035

NP_001345428
NP_001345429

Lokacija (UCSC)Chr 21: 25.72 – 25.74 MbChr 16: 84.62 – 84.63 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš
Mitohondrijski ATP sintazno-spregnuti faktor 6 (F6)
PDB 1vzs EBI.jpg
Struktura rastvora podjedinice f6 iz periferne regije drške ATP sintaze iz mitohondrija goveđeg srca
Identifikatori
SimbolATP-synt F6

Mitohondrijski ATP sintazno-spregnuti faktor 6 jest enzim koji je kod ljudi kodiran genom ATP5PF sa hromosoma 21.[5][6][7]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 108 aminokiselina, a molekulska težina 12.588 Da.[7]

1020304050
MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREY
KSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKF
EVIEKPQA

Funkcija[uredi | uredi izvor]

Mitohondrijska ATP-sintaza katalizira sintezu ATP-a, koristeći elektrohemijski gradijent protona preko unutrašnje membrane tokom oksidativne fosforilacije. Sastoji se od dva povezana kompleksa sa više podjedinica: rastvorljivo katalitsko jezgro, F1 i komponenta koja se proteže kroz membranu , FO, koji sadrže protonski kanal. Kompleks F1 sastoji se od pet različitih podjedinica (alfa, beta, gama, delta i epsilon), sastavljenih u omjeru od 3 alfa, 3 beta i po jednog predstavnika ostala trz. F O ima devet podjedinica (a, b, c, d, e, f, g, F6 i 8). Ovaj gen kodira F6 podjedinicu kompleksa FO, neophodnu za nterakcijeF1 i FO. Za ovaj gen identificirane su alternativno prerađene varijante transkripta koje kodiraju različite izoforme.[7]

Podjedinica F6 je dio periferne drške koja povezuje komplekse F1 i FO i koja djeluje kao stator, kako bi spriječila određene podjedinice da rotiraju sa centralnim rotirajućim element. Periferna drškaka razlikuje se u sastavu podjedinica između mitohondijskih, hloroplastnih i bakterijskih F-ATPaza. U mitohondrijAma, periferna drškaka sastoji se od po jedne kopije podjedinica OSCP (oligomicin senzitivni vezni protein), F6, b i d.[8] U bakterijskoj ili hloroplastnoj F-ATPazi, ne postoji homolog[ podjedinice F6, čije se periferne drške sastoje od jedne kopije podjedinice delta (homologne OSCP) i dvije kopije podjedinice b u bakterijama, ili jedne kopije svake od podjedinica b i b' u hloroplastima i fotosintetskim bakterijama.

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000154723 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000022890 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Higuti T, Tsurumi C, Kawamura Y, Tsujita H, Osaka F, Yoshihara Y, Tani I, Tanaka K, Ichihara A (Jul 1991). "Molecular cloning of cDNA for the import precursor of human coupling factor 6 of H(+)-ATP synthase in mitochondria". Biochemical and Biophysical Research Communications. 178 (2): 793–9. doi:10.1016/0006-291X(91)90178-A. PMID 1830479.
  6. ^ Javed AA, Ogata K, Sanadi DR (Jan 1991). "Human mitochondrial ATP synthase: cloning cDNA for the nuclear-encoded precursor of coupling factor 6". Gene. 97 (2): 307–10. doi:10.1016/0378-1119(91)90068-M. PMID 1825642.
  7. ^ a b c "Entrez Gene: ATP5PF ATP synthase peripheral stalk subunit F6".
  8. ^ Carbajo RJ, Kellas FA, Runswick MJ, Montgomery MG, Walker JE, Neuhaus D (Aug 2005). "Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit". Journal of Molecular Biology. 351 (4): 824–38. doi:10.1016/j.jmb.2005.06.012. PMID 16045926.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]

Ovaj članak uključuje tekst iz javnog domena Pfam i InterPro: IPR008387