BCKDHA

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
BCKDHA
Protein BCKDHA PDB 1dtw.png
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1DTW, 1OLS, 1OLU, 1OLX, 1U5B, 1V11, 1V16, 1V1M, 1V1R, 1WCI, 1X7W, 1X7X, 1X7Y, 1X7Z, 1X80, 2BEU, 2BEV, 2BEW, 2BFB, 2BFC, 2BFD, 2BFE, 2BFF, 2J9F

Identifikatori
AliasiBCKDHA
Vanjski ID-jeviOMIM: 608348 MGI: 107701 HomoloGene: 569 GeneCards: BCKDHA
Lokacija gena (čovjek)
Hromosom 19 (čovjek)
Hrom.Hromosom 19 (čovjek)[1]
Hromosom 19 (čovjek)
Genomska lokacija za BCKDHA
Genomska lokacija za BCKDHA
Bend19q13.2Početak41,397,808 bp[1]
Kraj41,425,002 bp[1]
Lokacija gena (miš)
Hromosom 7 (miš)
Hrom.Hromosom 7 (miš)[2]
Hromosom 7 (miš)
Genomska lokacija za BCKDHA
Genomska lokacija za BCKDHA
Bend7|7 A3Početak25,629,946 bp[2]
Kraj25,658,981 bp[2]
Ontologija gena
Molekularna funkcija oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor
GO:0001948 protein binding
metal ion binding
oxidoreductase activity
carboxy-lyase activity
3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) activity
Ćelijska komponenta mitochondrial alpha-ketoglutarate dehydrogenase complex
mitochondrial matrix
mitohondrija
Biološki proces metabolizam
branched-chain amino acid catabolic process
cellular nitrogen compound metabolic process
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001164783
NM_000709

NM_007533

RefSeq (bjelančevina)

NP_000700
NP_001158255

n/a

Lokacija (UCSC)Chr 19: 41.4 – 41.43 MbChr 7: 25.63 – 25.66 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Podjedinica alfa mitohondrijske 2-oksoizovalerat-dehidrogenaze je enzim koji je kod ljudi kodiran genom BCKDHA.[5]

BCKDHA je kodirajući gen kompleksa BCKD complex (razgranatih alfa-keto kiselih dehidrogenaza).

Otkriće[uredi | uredi izvor]

BCKDHA otkrio je John Menkes, 1954. Nakon što je vidio porodicu s četvero djece kako umire nakon samo nekoliko mjeseci nakon rođenja, otkrio je da im urin slatkasto miriše na javorov sirup. Iako nije bio taj koji je otkrio određeni gen, otkrio je bolest s mokraćom mirisa javorovog sirupa (MSUD). BCKD kompleks sastoji se od tri različita katalitska dijela. Bilo je to 1960. Godine, kada je Dancis otkrio sam gen, ali to je bilo od Menkesovog otkrića bolesti koja je dovela do daljeg istraživanja njenog porijekla. Otkrio je da je pogled na aminokiseline razgranatog lanca i njihove odgovarajuće alfa-keto kiseline, zauzvrat, pomogao u spoznaji da su patogenetski spojevi. Dancis je bio taj koji je posebno pronašao enzimski defekt (MSUD), pronašavši koji gen u bazenu ljudskih hromosoma oštećuje urin. Pronašao je gen na nivou dekarboksilacije aminokiselina razgranatog lanca.[6]

Lokus[uredi | uredi izvor]

Citogenetička lokacija BCKDHA nalazi se na ljudskom hromozomu 19, tačnije na pojasu u 19q13,2. Nalazi se dugom kraku (q) hromozoma 19, pozicija 13.2. Gledajući molekulsku lokaciju, nalaze se od baznog para 41,397.789 do 41,425.005 bp, na hromozomu 19. Ćelijska lokalizacija ovog gena nalazi se unutar mitohondrijskog matriksa.[7]

Aminokislinska sekvenca
1020304050
MAVAIAAARVWRLNRGLSQAALLLLRQPGARGLARSHPPRQQQQFSSLDD
KPQFPGASAEFIDKLEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKE
KVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDN
TDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKER
HFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGF
NFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDG
NDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDE
VNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERK
PKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDHFDK
Simboli

Funkcija[uredi | uredi izvor]

Drugi glavni korak u katabolizmu aminokiselina razgranatog lanca, kao što su izoleucin, leucin i valin, katalizira lančana alfa-keto kisela dehidrogenaza, kompleks (BCKD; EC 1.2.4.4), unutrašnji mitohondrijski enzimski kompleks koji se sastoji od 3 katalitske komponente: heterotetramerne (alfa2, beta2) dekarboksilaze alfa-keto kiseline razgranatog lanca (E1), homo-24-merne dihidrolipoil transakcilaze (E2; MIM 248610) i homodimerne dihidrolipoamid-dehidrogenaze (E3; MIM 238331). Reakcija je nepovratna i predstavlja prvi korak u oksidaciji BCAA. Kompleks također sadrži dva regulatorna enzima, kinazu i fosforilazu. Gen BCKDHA kodira alfa podjedinicu E1, a gen BCKDHB (MIM 248611) beta podjedinicu E1. (prema OMIM-u[5]

Normalna funkcija gena BCKDHA je davanje uputa za stvaranje alfa podjedinice enzimskog kompleksa alfa-keto dehidrogenaze razgranatog lanca (BCKD). Alfa podjedinica je jedan dio enzimskog kompleksa BCKD. Dvije beta podjedinice proizvedene su iz gena BCKDHB i povezuju se s dvije alfa podjedinice da bi se formirala komponenta E1 (dekarboksilaza). Enzimski kompleks BCKD katalizira jedan korak u razgradnji aminokiselina. Te aminokiseline su leucin, izoleucin i valin. Enzimski kompleks BCKD može se naći u mitohondrijama, organeli poznatoj kao pogonskoj ćelijskoj enargani. Sve tri aminokiseline mogu se naći u hrani bogatoj proteinima, a kad se razlože, mogu se koristiti za proizvodnju energije. Mutacije u genu BCKDHA mogu dovesti do bolesti s mokraćom mirisa javorovog sirupa.[8]

Klinički značaj[uredi | uredi izvor]

Mutacije u genu BCKDHA nastaju uslijed mutacija u jednoj tački u „alfa podjedinic eenzimskog kompleksa BCKD”.[9] Raniji slučajevi ove bolesti pokazuju da se mutacija češće javljala zamjenom aminokiseline tirozin. Ova aminokiselina zamijenjena je asparaginom. Komplikacija s mutacijama gena BCKDHA je u tome što on remeti normalnu funkciju enzima BCKD, sprečavajući gen da u osnovi obavlja svoje normalne funkcije. Dakle, gen BCKDHA ne bi mogao razgraditi leucin, izoleucin i valin. Kada se ovi nusproizvodi počnu akumulirati, stvara se toksično okruženje za ćelije i tkiva, posebno u nervnom sistemu. To može dovesti do napadaja, kašnjenja u razvoju, ali što je najvažnije bolesti s mokraćom mirisa javorovog sirupa.

BCKDHA je precizno naznačen kod ljudi sa bolešću urina sa mirisom javorovog sirupa, zbog preko 80 mutacija koje su se dogodile u tom genu. Iz ovih mutacija proizlaze teški simptomi i uzrokuju bolest koja se pokazuje ubrzo nakon rođenja. Zbog slatkastog mirisa urina, bolest je nazvana bolest s mokraćom mirisa javorovog sirupa. Bolest uzrokuje gubitak apetita, mučninu, letargiju i usporen razvoj.

BCKDHA mutacija: bolest s mokraćom mirisom javorovog sirupa[uredi | uredi izvor]

Bolest s urinom mitrisa javorovog sirupa je autosomno recesivna urođena greška metabolizma. Znači, kao što je ranije rečeno, da postoji defekt (tj. greška) u pojedinačnom genu koji kodira enzim. Ovi enzimi pospješuju pretvaranje različitih supstrata u proizvode. U pogledu bolesti ovakve mokraće, enzimski defekt se javlja u metaboličkom putu aminokiselina razgranatog lanca, leucin, izoleucin i valin. Nakupljanje ovih aminokiselina dovodi do „encefalopatije i progresivne neurodegeneracije”;[10] zajedno sa ostalim komplikacijama.

Postoji pet oblika bolesti s mokraćom mirisa javorovog sirupa: intermedijarni, intermitentni, reagirajući na tiamin i sa nedostatkom E3. Oblik bolesti ovisi o kliničkoj prognozi, toleranciji na proteine u prehrani, te tiaminskom odgovoru i nivou aktivnosti enzima. Intermedijarna bolest javorovog sirupa blaži je oblik bolesti javorovog sirupa, jer uporno podiže razinu aminokiselina razgranatog lanca i nekih lanaca keto-kiselina. Osobe s ovom bolešću imaju djelomični nedostatak enzima BCKDHA. To znači da se pojavljuje sporadično ili reagira na dijetalnu terapiju tiaminom.

References[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000248098 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000060376 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b "Entrez Gene: BCKDHA branched chain keto acid dehydrogenase E1, alpha polypeptide".
  6. ^ Reference, Genetics Home. "BCKDHA gene". Genetics Home Reference (jezik: engleski). Pristupljeno 15. 11. 2018.
  7. ^ "BCKDHA branched chain keto acid dehydrogenase E1, alpha polypeptide". NCBI. Pristupljeno 12. 4. 2019.
  8. ^ Database, GeneCards Human Gene. "BCKDHA Gene - GeneCards | ODBA Protein | ODBA Antibody". www.genecards.org. Pristupljeno 15. 11. 2018.
  9. ^ Reference, Genetics Home. "BCKDHA gene". Genetics Home Reference (jezik: engleski). Pristupljeno 14. 11. 2018.
  10. ^ Database, GeneCards Human Gene. "BCKDHA Gene - GeneCards | ODBA Protein | ODBA Antibody". www.genecards.org. Pristupljeno 14. 11. 2018.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]

Šablon:Multienzimski kompleksi Šablon:Aldehid/Okso oksidoreduktaze Šablon:Proteinske kinaze specifične za serin/treonin