C-reaktivni protein

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
CRP
PDB 1b09 EBI.jpg
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1B09, 1GNH, 1LJ7, 3L2Y, 3PVN, 3PVO

Identifikatori
AliasiCRP
Vanjski ID-jeviOMIM: 123260 MGI: 88512 HomoloGene: 128039 GeneCards: CRP
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za CRP
Genomska lokacija za CRP
Bend1q23.2Početak159,712,289 bp[1]
Kraj159,714,589 bp[1]
Lokacija gena (miš)
Hromosom 1 (miš)
Hrom.Hromosom 1 (miš)[2]
Hromosom 1 (miš)
Genomska lokacija za CRP
Genomska lokacija za CRP
Bend1 H3|1 80.13 cMPočetak172,525,622 bp[2]
Kraj172,660,598 bp[2]
Obrazac RNK ekspresije
PBB GE CRP 205753 at fs.png

PBB GE CRP 37020 at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija low-density lipoprotein particle receptor binding
calcium ion binding
virion binding
complement component C1q complex binding
GO:0001948 protein binding
metal ion binding
low-density lipoprotein particle binding
choline binding
identical protein binding
Ćelijska komponenta extracellular region
Vanćelijsko
Biološki proces negative regulation of lipid storage
positive regulation of superoxide anion generation
positive regulation of gene expression
inflammatory response
acute-phase response
negative regulation of macrophage derived foam cell differentiation
opsonization
GO:0051637 defense response to Gram-positive bacterium
complement activation, classical pathway
Urođeni imunski sistem
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_000567
NM_001329057
NM_001329058
NM_001382703

NM_007768

RefSeq (bjelančevina)

NP_000558
NP_001315986
NP_001315987
NP_001369632

NP_031794

Lokacija (UCSC)Chr 1: 159.71 – 159.71 MbChr 1: 172.53 – 172.66 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

C-reaktivni protein (CRP) jest protein koji je kod ljudi kodiran genom sa hromosoma 1. To je prstenasti (prstenoliki) pentamerni protein koji se nalazi u krvnoj plazmi, čije koncentracije u cirkulaciji rastu kao odgovor na upale. To je protein akutne faze jetrenog porijekla koji se povećava nakon lučenja interleukina-6 makrofaga i T-ćelija. Njegova fiziološka uloga je da se veže za lizofosfatidilholin eksprimiran na površini mrtvih ili umirućih ćelija (i nekih vrsta bakterija), kako bi se aktivirao sistem komplementa preko C1q.[5]

CRP se sintetiše pomoću jetre[6] kao odgovor na faktore koji oslobađaju makrofagii i masne ćelije (adipociti).[7] Član je pentraksinske porodice proteina.[6] Nije povezan sa C-peptidom (insulin) ili proteinom C (koagulacija krvi). C-reaktivni protein je bio prvi receptor prepoznavanja uzoraka (PRR) koji je identificiran.[8]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 224 aminokiseline, a molekulska težina 25.039 Da.[9].

1020304050
MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA
FTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEI
LFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLKKGYTVGAEAS
IILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSP
NVLNWRALKYEVQGEVFTKPQLWP

Historija[uredi | uredi izvor]

Otkrili su ga Tillett i Francis 1930.[10] U početku se mislilo da bi CRP mogao biti patogeni sekret jer je bio povišen kod raznih bolesti, uključujući rak.[6] Kasnije otkriće jetrene sinteze (napravljene u jetri) pokazalo je da je to prirodni protein.[11][12][13] U početku, CRP je mjeren pomoću reakcija gušenja, što je dalo pozitivan ili negativan rezultat. Preciznije metode danas koriste dinamičko raspršivanje svjetlosti nakon reakcije sa CRP-specifičnim antitijelima.[14]

Nomenklatura[uredi | uredi izvor]

CRP je tako nazvan jer je prvi put identifikovan kao supstanca u serumu pacijenata sa akutnom upalom koja je reagovala sa kapsulski polisaharid (C-polisaharid) pneumokoka.[15]

Genetika i struktura[uredi | uredi izvor]

Gen CRP nalazi se na hromosomu 1 (1q23.2)[16]). Član je male porodice pentraksini . Monomer ima 224 aminokiseline,[17] i molekulsku masu od 25.106 Da. Kompletan protein, sastavljen od pet monomera, ima ukupnu masu od približno 120.000 Da. U serumu se sklapa u stabilnu pentamernu strukturu diskoidnog oblika.

Funkcija[uredi | uredi izvor]

CRP se vezuje za fosfoholin eksprimiran na površini mrtvih ili umirućih ćelija i nekih bakterija. Ovo aktivira sistem komplementa, pokrećući fagocitozu pomoću makrofaga, što čisti nekrozne i apoptotske ćelije i bakterije.[14]

Ovaj takozvani odgovor akutne faze nastaje kao rezultat povećanja koncentracije IL-6, koga također proizvode makrofagi [6] kao adipocite[7] u odgovoru na širok spektar akutnih i hroničnih upalnih stanja kao što su bakterijske, virusne ili gljivične infekcije; reumatske i druge upalne bolesti, malignpst i ozljede i nekroze tkiva. Ova stanja uzrokuju oslobađanje interleukina-6 i drugih citokina, koji u jetri pokreću sintezu CRP-a i fibrinogena.

CRP se vezuje za fosfoholin na mikroorganizmima. Smatra se da pomaže u vezivanju komplementa za strane i oštećene ćelije i pojačava fagocitozu makrofaga (opsonin-posredovana fagocitoza), koji eksprimiraju receptor za CRP. Ima ulogu u urođenoj imunosti kao rani sistem odbrane od infekcija.[14]

Razine seruma[uredi | uredi izvor]

C-reaktivni protein
Klasifikacija i vanjski resursi

Metodi mjerenja[uredi | uredi izvor]

Tradicijsko mjerenje CRP-a detektira samo CRP u rasponu od 10  do  1,000  mg/L, dok CRP visoke osjetljivosti (hs-CRP) detektuje CRP u rasponu od 0,5  do  10   mg/L.[18] Ljudsi hs-CRP može otkriti rizik kardiovaskularne bolesti kada je veći od 3 mg/L, dok bi ispod 1 mg/L bio nizak rizik.[19] Tradicijsko mjerenje CRP-a je brže i jeftinije od hs-CRP-a i može biti adekvatno za neke primjene, kao što je praćenje hemodijaliza pacijenata.[20]

Normalno[uredi | uredi izvor]

Kod zdravih odraslih osoba, normalne koncentracije CRP variraju između 0,8 mg/L i 3,0  mg/L. Međutim, neke zdrave odrasle osobe pokazuju povišen CRP na 10 mg/L. Koncentracije CRP se također povećavaju s godinama, vjerovatno zbog subkliničkih stanja. Također nema sezonskih varijacija koncentracija CRP-a. Genetički polimorfizam porodice interleukina-1, interleukin 6 i polimorfni GT ponavljanje CRP gena utiču na uobičajene koncentracije CRP-a kada osoba nema nikakve medicinske bolesti.[6] Poluživot CRP-a u plazmi je 19 sati i konstantan je u svim medicinskim stanjima.

Akutna upala[uredi | uredi izvor]

Kada postoji stimulans, nivo CRP se može povećati 10.000 puta sa manje od 50 μg/L na više od 500 mg/L. Njegova koncentracija može porasti na 5 mg/L za šest sati i dostići vrhunac za 48 sati. Stoga je njegova brzina proizvodnje jedini faktor koji utiče na koncentraciju CRP-a u krvi, koja se povećava s upalom, infekcijom, traumom, nekrozom, malignošću i alergijskim reakcijama. Drugi upalni medijatori koji mogu povećati CRP su TGF-beta 1 i faktor nekroze tumora alfa. Kod akutne upale, CRP se može povećati za čak 50 do 100 mg/L u roku od 4 – 6 sati kod blage do umjerene upale ili inzulta kao što je infekcija kože, cistitis ili bronhitis. Može se udvostručiti svakih osam sati i dostići svoj vrhunac za 36 do 50 sati nakon ozljede ili upale. CRP između 100 i 500 mg/L smatra se visoko prediktivnim za upalu uzrokovanu bakterijskom infekcijom. Kada se upala smiri, nivo CRP-a brzo opada zbog njegovog relativno kratkog poluživota.[14]

Hronična upala[uredi | uredi izvor]

Koncentracije CRP-a između 2 i 10 mg/L smatraju se metaboličkom upalom: metabolički putevi koji uzrokuju arteriosklerozu i dijabetes melitus tipa II.

Klinički značaj[uredi | uredi izvor]

Dijagnostička upotreba[uredi | uredi izvor]

CRP se uglavnom koristi kao marker upale. Osim za zatajenje jetre, postoji nekoliko poznatih faktora koji ometaju proizvodnju CRP-a.[6] Interferon alfa inhibira proizvodnju CRP-a iz ćelija jetre, što može objasniti relativno nizak nivo CRP-a koji se nalazi tokom virusnih infekcija u poređenju sa bakterijskim infekcijama [21]

Mjerenje i mapiranje vrijednosti CRP-a može se pokazati korisnim u određivanju napredovanja bolesti ili učinkovitosti tretmana. ELISA, imunoturbidimetrija, nefelometrija, radijalna imunodifuzija[19][22]

  • nizak: nivo hs-CRP ispod 1,0 mg/L
  • prosjek: između 1,0 i 3,0 mg/L
  • visok: iznad 3,0 mg/L

Normalni nivoi se povećavaju sa starenjem.[23] Viši nivoi nalaze se kod kasnih trudnih žena, blage upale i virusne infekcije (10–40 mg/L), aktivne upale, bakterijske infekcije (40–200 mg/L ), teške bakterijske infekcije i opekotine (>200 mg/L).[24]

Granične razine CRP-a koje razlikuju bakterijsku od nebakterijsku bolest mogu varirati zbog komorbiditeta kao što su malarija, HIV i pothranjenost i faze prezentacije bolesti.[25]

CRP je osjetljiviji i precizniji odraz odgovora akutne faze od odgovora ESR[26] (brzina sedimentacije eritrocita). ESR može biti normalan dok je CRP povišen. CRP se vraća u normalu brže od ESR kao odgovor na terapiju.

Kardiovaskularne bolesti[uredi | uredi izvor]

Nedavna istraživanja sugeriraju da su pacijenti s povišenim bazim razinama CRP-a pod povećanim rizikom od dijabetesa,[27][28] hipertenzija i kardiovaskularnih bolesti. Studija na preko 700 medicinskih sestara pokazala je da su one koje su konzumirale najveće kvartile konzumacije transmasti imale nivoe CRP-a u krvi koje su bile 73% veće od onih u najnižem kvartilu.[29] Iako je jedna grupa istraživača navela da CRP može biti samo umjereni faktor rizika za kardiovaskularne bolesti,[30] utvrđeno je da ova studija (poznata kao Reykjavik studija) ima neke probleme za ovu vrstu analize u vezi sa karakteristikama proučavane populacije, a postojalo je i izuzetno dugo vrijeme praćenja, što je možda umanjilo povezanost između CRP-a i budućih ishoda.[31] Drugi su pokazali da CRP može pogoršati ishemijsku nekrozu na komplement-ovisan način i da inhibicija CRP može biti sigurna i učinkovita terapija za miokardni i moždani infarkt; do sada je to pokazano samo na životinjskim modelima.[32]

Pretpostavlja se da bi pacijenti sa visokim nivoom CRP-a mogli imati koristi od upotrebe statina. Ovo se zasniva na JUPITER-pokusu koji je otkrio da su povišeni nivoi CRP-a bez hiperlipidemije koristili. Odabrani su statini jer je dokazano da smanjuju nivoe CRP-a.[6][33] Studije koje su upoređivale učinak različitih statina na hs-CRP otkrile su slične efekte tih statina.[34][35] Međutim, naknadno ispitivanje nije pokazalo da je CRP koristan za određivanje koristi od statina.[36]

U metaanalizi 20 studija koje su uključivale 1.466 pacijenata sa koronarnom bolešću, otkriveno je da su nivoi CRP smanjeni nakon intervencija vježbanjem. Među tim studijama, veće koncentracije CRP-a ili lošiji profili lipida prije početka vježbanja bili su povezani s većim smanjenjem CRP-a.[37]

Da bi se razjasnilo da li je CRP posmatrač ili aktivni učesnik u aterogenezi, studija iz 2008. upoređivala je ljude sa različitim genetičkim varijantama CRP-a. Oni sa visokim CRP-om zbog genetičke osnove nisu imali povećan rizik od kardiovaskularnih bolesti, u poređenju sa onima sa normalnim ili niskim CRP-om.[38] Studija objavljena 2011. pokazuje da je CRP povezan s odgovorima lipida na ishranu s niskim udjelom masti i visokim sadržajem polinezasićenih masti.[39]

Rizik od koronarne bolesti srca[uredi | uredi izvor]

Oštećenje arterija je rezultat invazije bijelih krvnih zrnaca i upale unutar zida. CRP je opći marker za upalu i infekciju, tako da se može koristiti kao vrlo grubi pokazatelj rizika od srčanih bolesti. Budući da mnogi faktori mogu uzrokovati povišen CRP, ovo nije vrlo specifičnni prognostički indikator.[40][41] Ipak, nivo iznad 2,4  mg/L povezan je sa udvostručenim rizikom od koronarne bolesti u poređenju sa nivoima ispod 1 mg/L;[6] međutim, ispitivana grupa u ovom slučaju sastojala se od pacijenata kojima je dijagnosticirana nestabilna angina pektoris; ostaje nejasno da li povišeni CRP ima bilo kakvu prediktivnu vrijednost akutnih koronarnih poteškoća u općoj populaciji svih starosnih grupa. Sada se C-reaktivni protein ne preporučuje kao skrining test za kardiovaskularne bolesti za prosječno rizične odrasle osobe bez simptoma.[42]

Američka asocija za srce i američki Centri za kontrolu i prevenciju bolesti definirali su rizične grupe na sljedeći način:[19][43]

  • Nizak rizik: manje od 1,0 mg/L
  • Prosječan rizik: 1,0 do 3,0 mg/L
  • Visok rizik: iznad 3,0 mg/L

Ali hs-CRP se ne koristi sam i treba ga kombinovati sa lijekovima zha povišene nivoe holesterola, LDL-C, triglicerida i nivoa glukoze. Pušenje, hipertenzija i dijabetes također povećavaju nivo rizika od kardiovaskularnih bolesti.

Fibroza i upala[uredi | uredi izvor]

Skleroderma, polimiozitis i dermatomiozitis izazivaju mali ili nikakav CRP odgovor. Nivoi CRP-a takođe obično ne budu povišeni kod SLE osim ako nije prisutan serozitis ili sinovitis. Povišenje CRP-a u odsustvu klinički značajne upale može se javiti kod zatajenja bubrega. Nivo CRP je nezavisan faktor rizika za aterosklerotsku bolest. Pacijenti s visokim koncentracijama CRP-a imaju veću vjerovatnoću da će razviti moždani udar, infarkt miokarda i tešku perifernu vaskularnu bolest.[44] Povišen nivo CRP-a se takođe može primijetiti kod upalne bolesti crijeva (IBD), uključujući Crohnovu bolest i ulcerozni kolitis.[26]

Visoki nivoi CRP-a su vezani zaa tačkaste mutacije Cys130Arg u "APOE" genu, koji kodira apolipoprotein E, uspostavljajući vezu između vrijednosti lipida i modulacije upalnih markera.[45]

Kancer[uredi | uredi izvor]

Uloga upale u raku nije dobro shvaćena. Neki organi u tijelu pokazuju veći rizik od raka kada su kronično upaljeni.[46] Iako postoji povezanost između povećanog nivoa C-reaktivnog proteina i rizika od razvoja raka, ne postoji povezanost između genetičkih polimorfizama koji utječu na cirkulirajući nivo CRP-a i rizika od raka.[47]

U 2004. prospektivna kohortna studija o riziku od raka debelog crijeva povezanom s razinama CRP-a, osobe s rakom debelog crijeva imale su višu prosječnu koncentraciju CRP-a od ljudi bez raka debelog crijeva.[48] Može se primijetiti da su prosječni nivoi CRP-a u obje grupe bili u granicama raspona nivoa CRP-a koji se obično nalazi kod zdravih ljudi. Međutim, ovi nalazi mogu sugerirati da nizak nivo upale može biti povezan sa manjim rizikom od raka debelog crijeva, u skladu s prethodnim studijama koje pokazuju da protivupalni lijekovi mogu smanjiti rizik od raka debelog crijeva.[49]

Opstruktivna apneja u snu[uredi | uredi izvor]

C-reaktivni protein (CRP), marker sistemske upale, također je povećan kod opstruktivne apneje u snu (OSA). Nivoi CRP-a i interleukina-6 (IL-6) bili su značajno viši kod pacijenata sa OSA, u poređenju sa gojaznim kontrolnim subjektima.[50] Pacijenti sa OSA imaju više koncentracije CRP u plazmi koje su se povećale u skladu sa težinom njihovog indeksa apneja-hipopneja. Tretman OSA sa CPAP-om (kontinuirani pozitivni pritisak u disajnim putevima) značajno je ublažio efekat OSA na nivoe CRP-a i IL-6.[50]

Reumatoidni artritis[uredi | uredi izvor]

Ranije se spekulisalo da jednonukleotidni polimorfizmi u CRP genu mogu uticati na kliničko odlučivanje na osnovu CRP-a kod reumatoidnog artritisa, npr. DAS28 (skor aktivnosti bolesti 28 zglobova). Nedavna studija je pokazala da su genotip i haplotip CRP samo marginalno povezani sa nivoima CRP u serumu i bez ikakve povezanosti sa DAS28 skorom.[51] Dakle, taj DAS28, koji je osnovni parametar za ujpalnu aktivnost u RA, može se koristiti za kliničko donošenje odluka bez prilagođavanja za varijante CRP gena.

Virusne infekcije[uredi | uredi izvor]

Povećani nivoi CRP-a u krvi bili su viši kod ljudi sa ptičjim gripom H7N9 u poređenju sa onima sa H1N1 (češćom) gripom,[52] s pregledom koji je izvijestio da je teška H1N1 gripa imala povišen CRP.[53] Godine 2020., ljudi zaraženi COVID-19 u Wuhanu, Kina imali su povišen CRP.[54][55][56]

Dodatne slike[uredi | uredi izvor]

Također pogledajte[uredi | uredi izvor]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000132693 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000037942 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Thompson D, Pepys MB, Wood SP (februar 1999). "The physiological structure of human C-reactive protein and its complex with phosphocholine". Structure. 7 (2): 169–77. doi:10.1016/S0969-2126(99)80023-9. PMID 10368284.
  6. ^ a b c d e f g h Pepys MB, Hirschfield GM (juni 2003). "C-reactive protein: a critical update". The Journal of Clinical Investigation. 111 (12): 1805–12. doi:10.1172/JCI18921. PMC 161431. PMID 12813013.
  7. ^ a b Lau DC, Dhillon B, Yan H, Szmitko PE, Verma S (maj 2005). "Adipokines: molecular links between obesity and atheroslcerosis". American Journal of Physiology. Heart and Circulatory Physiology. 288 (5): H2031–41. doi:10.1152/ajpheart.01058.2004. PMID 15653761.
  8. ^ Mantovani A, Garlanda C, Doni A, Bottazzi B (januar 2008). "Pentraxins in innate immunity: from C-reactive protein to the long pentraxin PTX3". Journal of Clinical Immunology. 28 (1): 1–13. doi:10.1007/s10875-007-9126-7. PMID 17828584. S2CID 20300531.
  9. ^ "UniProt, P02741" (jezik: англ.). Pristupljeno 25 серпня 2017. Provjerite vrijednost datuma u parametru: |access-date= (pomoć)CS1 održavanje: nepoznati jezik (link)
  10. ^ Tillett WS, Francis T (septembar 1930). "Serological reactions in pneumonia with a nonprotein somatic fraction of pneumococcus". The Journal of Experimental Medicine. 52 (4): 561–71. doi:10.1084/jem.52.4.561. PMC 2131884. PMID 19869788.
  11. ^ Kennelly PJ, Murray RF, Rodwell VW, Botham KM (2009). Harper's illustrated biochemistry. McGraw-Hill Medical. ISBN 978-0-07-162591-3.
  12. ^ Pincus MR, McPherson RA, Henry JB (2007). Henry's clinical diagnosis and management by laboratory methods. Saunders Elsevier. ISBN 978-1-4160-0287-1.
  13. ^ Ratey JJ, Noskin GA, Braun R, Hanley EN Jr, McInnes IB, Ruddy S (2008). Kelley's Textbook of Rheumatology: 2-Volume Set, Expert Consult: Online and Print (Textbook of Rheumatology (Kelley's)(2 Vol)). Philadelphia: Saunders. ISBN 978-1-4160-3285-4.
  14. ^ a b c d Bray C, Bell LN, Liang H, Haykal R, Kaiksow F, Mazza JJ, Yale SH (decembar 2016). "Erythrocyte Sedimentation Rate and C-reactive Protein Measurements and Their Relevance in Clinical Medicine" (PDF). Wisconsin Medical Journal (WMJ). 115 (6): 317–21. PMID 29094869.
  15. ^ Mold C, Nakayama S, Holzer TJ, Gewurz H, Du Clos TW (novembar 1981). "C-reactive protein is protective against Streptococcus pneumoniae infection in mice". The Journal of Experimental Medicine. 154 (5): 1703–8. doi:10.1084/jem.154.5.1703. PMC 2186532. PMID 7299351.
  16. ^ "CRP C-reactive protein [Homo sapiens]". Entrez Gene. National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine.
  17. ^ "#CAA39671". NCBI Entrez Protein.
  18. ^ Knight, Michelle L. (18. 2. 2015). "The Application of High-Sensitivity C-Reactive Protein in Clinical Practice: A 2015 Update". Cardiovascular. U.S. Pharmacist. Pristupljeno 28. 12. 2020.
  19. ^ a b c Pearson TA, Mensah GA, Alexander RW, Anderson JL (2003). "Markers of inflammation and cardiovascular disease: application to clinical and public health practice: A statement for healthcare professionals from the Centers for Disease Control and Prevention and the American Heart Association". Circulation. 107 (3): 499–511. doi:10.1161/01.cir.0000052939.59093.45. PMID 12551878.
  20. ^ Helal I, Zerelli L, Krid M, Kheder A (2012). "Comparison of C-reactive protein and high-sensitivity C-reactive protein levels in patients on hemodialysis" (PDF). Saudi Journal of Kidney Disease and Transplantation. 23 (3): 477–483. PMID 22569431. Arhivirano s originala (PDF), 9. 12. 2021. Pristupljeno 9. 12. 2021.
  21. ^ Enocsson H, Sjöwall C, Skogh T, Eloranta ML, Rönnblom L, Wetterö J (decembar 2009). "Interferon-alpha mediates suppression of C-reactive protein: explanation for muted C-reactive protein response in lupus flares?". Arthritis and Rheumatism. 60 (12): 3755–60. doi:10.1002/art.25042. PMID 19950271.
  22. ^ von Schenck, H.; Grützmeier, S. (1989). "Four immunochemical methods for measuring C-reactive protein in plasma compared". Clinical Chemistry. str. 461–463. doi:10.1093/clinchem/35.3.461. PMID 2493344.
  23. ^ Thomas, Lothar, Labor und Diagnose. TH-Books, Frankfurt, 2008, p. 1010
  24. ^ Chew KS (april 2012). "What's new in Emergencies Trauma and Shock? C-reactive protein as a potential clinical biomarker for influenza infection: More questions than answers". Journal of Emergencies, Trauma, and Shock. 5 (2): 115–7. doi:10.4103/0974-2700.96477. PMC 3391832. PMID 22787338.
  25. ^ Dittrich S, Tadesse BT, Moussy F, Chua A, Zorzet A, Tängdén T, et al. (25. 8. 2016). Yansouni C (ured.). "Target Product Profile for a Diagnostic Assay to Differentiate between Bacterial and Non-Bacterial Infections and Reduce Antimicrobial Overuse in Resource-Limited Settings: An Expert Consensus". PLOS ONE. 11 (8): e0161721. Bibcode:2016PLoSO..1161721D. doi:10.1371/journal.pone.0161721. PMC 4999186. PMID 27559728.
  26. ^ a b Liu S, Ren J, Xia Q, Wu X, Han G, Ren H, Yan D, Wang G, Gu G, Li J (decembar 2013). "Preliminary case-control study to evaluate diagnostic values of C-reactive protein and erythrocyte sedimentation rate in differentiating active Crohn's disease from intestinal lymphoma, intestinal tuberculosis and Behcet's syndrome". The American Journal of the Medical Sciences. 346 (6): 467–72. doi:10.1097/MAJ.0b013e3182959a18. PMID 23689052. S2CID 5173681.
  27. ^ Pradhan AD, Manson JE, Rifai N, Buring JE, Ridker PM (juli 2001). "C-reactive protein, interleukin 6, and risk of developing type 2 diabetes mellitus". JAMA. 286 (3): 327–34. doi:10.1001/jama.286.3.327. PMID 11466099.
  28. ^ Dehghan A, Kardys I, de Maat MP, Uitterlinden AG, Sijbrands EJ, Bootsma AH, et al. (mart 2007). "Genetic variation, C-reactive protein levels, and incidence of diabetes". Diabetes. 56 (3): 872–8. doi:10.2337/db06-0922. PMID 17327459.
  29. ^ Lopez-Garcia E, Schulze MB, Meigs JB, Manson JE, Rifai N, Stampfer MJ, et al. (mart 2005). "Consumption of trans fatty acids is related to plasma biomarkers of inflammation and endothelial dysfunction". The Journal of Nutrition. 135 (3): 562–6. doi:10.1093/jn/135.3.562. PMID 15735094.
  30. ^ Danesh J, Wheeler JG, Hirschfield GM, Eda S, Eiriksdottir G, Rumley A, et al. (april 2004). "C-reactive protein and other circulating markers of inflammation in the prediction of coronary heart disease". The New England Journal of Medicine. 350 (14): 1387–97. doi:10.1056/NEJMoa032804. PMID 15070788.
  31. ^ Koenig, Wolfgang (2006). "C-reactive protein - a critical cardiovascular risk marker". CRPhealth.com.
  32. ^ Pepys MB, Hirschfield GM, Tennent GA, Gallimore JR, Kahan MC, Bellotti V, et al. (april 2006). "Targeting C-reactive protein for the treatment of cardiovascular disease". Nature. 440 (7088): 1217–21. Bibcode:2006Natur.440.1217P. doi:10.1038/nature04672. PMID 16642000. S2CID 4324584.
  33. ^ Ridker PM, Danielson E, Fonseca FA, Genest J, Gotto AM, Kastelein JJ, et al. (novembar 2008). "Rosuvastatin to prevent vascular events in men and women with elevated C-reactive protein". The New England Journal of Medicine. 359 (21): 2195–207. doi:10.1056/NEJMoa0807646. PMID 18997196.
  34. ^ Sindhu S, Singh HK, Salman MT, Fatima J, Verma VK (oktobar 2011). "Effects of atorvastatin and rosuvastatin on high-sensitivity C-reactive protein and lipid profile in obese type 2 diabetes mellitus patients". Journal of Pharmacology & Pharmacotherapeutics. 2 (4): 261–5. doi:10.4103/0976-500X.85954. PMC 3198521. PMID 22025854.
  35. ^ Jialal I, Stein D, Balis D, Grundy SM, Adams-Huet B, Devaraj S (april 2001). "Effect of hydroxymethyl glutaryl coenzyme a reductase inhibitor therapy on high sensitive C-reactive protein levels". Circulation. 103 (15): 1933–5. doi:10.1161/01.CIR.103.15.1933. PMID 11306519.
  36. ^ Heart Protection Study Collaborative Group, Emberson J, Bennett D, Link E, Parish S, Danesh J, Armitage J, Collins R (februar 2011). "C-reactive protein concentration and the vascular benefits of statin therapy: an analysis of 20,536 patients in the Heart Protection Study". Lancet. 377 (9764): 469–76. doi:10.1016/S0140-6736(10)62174-5. PMC 3042687. PMID 21277016.
  37. ^ Swardfager W, Herrmann N, Cornish S, Mazereeuw G, Marzolini S, Sham L, Lanctôt KL (april 2012). "Exercise intervention and inflammatory markers in coronary artery disease: a meta-analysis". American Heart Journal. 163 (4): 666–76.e1–3. doi:10.1016/j.ahj.2011.12.017. PMID 22520533.
  38. ^ Zacho J, Tybjaerg-Hansen A, Jensen JS, Grande P, Sillesen H, Nordestgaard BG (oktobar 2008). "Genetically elevated C-reactive protein and ischemic vascular disease". The New England Journal of Medicine. 359 (18): 1897–908. doi:10.1056/NEJMoa0707402. PMID 18971492.
  39. ^ St-Onge MP, Zhang S, Darnell B, Allison DB (april 2009). "Baseline serum C-reactive protein is associated with lipid responses to low-fat and high-polyunsaturated fat diets". The Journal of Nutrition. 139 (4): 680–3. doi:10.3945/jn.108.098251. PMC 2666362. PMID 19297430.
  40. ^ Lloyd-Jones DM, Liu K, Tian L, Greenland P (juli 2006). "Narrative review: Assessment of C-reactive protein in risk prediction for cardiovascular disease". Annals of Internal Medicine. 145 (1): 35–42. doi:10.7326/0003-4819-145-1-200607040-00129. PMID 16818927.
  41. ^ Bower JK, Lazo M, Juraschek SP, Selvin E (oktobar 2012). "Within-person variability in high-sensitivity C-reactive protein". Archives of Internal Medicine. 172 (19): 1519–21. doi:10.1001/archinternmed.2012.3712. PMC 3613132. PMID 22945505.
  42. ^ Goldman L (2011). Goldman's Cecil Medicine (24th izd.). Philadelphia: Elsevier Saunders. str. 54. ISBN 978-1437727883.
  43. ^ "hs-CRP". Pristupljeno 3. 6. 2013.
  44. ^ Clearfield MB (septembar 2005). "C-reactive protein: a new risk assessment tool for cardiovascular disease". The Journal of the American Osteopathic Association. 105 (9): 409–16. PMID 16239491. Arhivirano s originala, 10. 1. 2012. Pristupljeno 10. 2. 2013.
  45. ^ Sidore C, Busonero F, Maschio A, Porcu E, Naitza S, Zoledziewska M, et al. (novembar 2015). "Genome sequencing elucidates Sardinian genetic architecture and augments association analyses for lipid and blood inflammatory markers". Nature Genetics. 47 (11): 1272–1281. doi:10.1038/ng.3368. PMC 4627508. PMID 26366554.
  46. ^ Lu H, Ouyang W, Huang C (april 2006). "Inflammation, a key event in cancer development". Molecular Cancer Research. 4 (4): 221–33. doi:10.1158/1541-7786.MCR-05-0261. PMID 16603636.
  47. ^ Allin KH, Nordestgaard BG (2011). "Elevated C-reactive protein in the diagnosis, prognosis, and cause of cancer". Critical Reviews in Clinical Laboratory Sciences. 48 (4): 155–70. doi:10.3109/10408363.2011.599831. PMID 22035340. S2CID 40322991.
  48. ^ Erlinger TP, Platz EA, Rifai N, Helzlsouer KJ (februar 2004). "C-reactive protein and the risk of incident colorectal cancer". JAMA. 291 (5): 585–90. doi:10.1001/jama.291.5.585. PMID 14762037.
  49. ^ Baron JA, Cole BF, Sandler RS, Haile RW, Ahnen D, Bresalier R, et al. (mart 2003). "A randomized trial of aspirin to prevent colorectal adenomas". The New England Journal of Medicine. 348 (10): 891–9. doi:10.1056/NEJMoa021735. PMID 12621133.
  50. ^ a b Latina JM, Estes NA, Garlitski AC (2013). "The Relationship between Obstructive Sleep Apnea and Atrial Fibrillation: A Complex Interplay". Pulmonary Medicine. 2013: 1–11. doi:10.1155/2013/621736. PMC 3600315. PMID 23533751.
  51. ^ Ammitzbøll CG, Steffensen R, Bøgsted M, Hørslev-Petersen K, Hetland ML, Junker P, et al. (oktobar 2014). "CRP genotype and haplotype associations with serum C-reactive protein level and DAS28 in untreated early rheumatoid arthritis patients". Arthritis Research & Therapy. 16 (5): 475. doi:10.1186/s13075-014-0475-3. PMC 4247621. PMID 25359432.
  52. ^ Wu W, Shi D, Fang D, Guo F, Guo J, Huang F, et al. (mart 2016). "A new perspective on C-reactive protein in H7N9 infections". Int J Infect Dis. 44: 31–36. doi:10.1016/j.ijid.2016.01.009. PMID 26809124.
  53. ^ Vasileva D, Badawi A (januar 2019). "C-reactive protein as a biomarker of severe H1N1 influenza". Inflamm Res. 68 (1): 39–46. doi:10.1007/s00011-018-1188-x. PMC 6314979. PMID 30288556.
  54. ^ Wang D, Hu B, Hu C, Zhu F, Liu X, Zhang J, et al. (7. 2. 2020). "Clinical Characteristics of 138 Hospitalized Patients With 2019 Novel Coronavirus-Infected Pneumonia in Wuhan, China". JAMA. 323 (11): 1061–1069. doi:10.1001/jama.2020.1585. PMC 7042881. PMID 32031570.
  55. ^ Chen N, Zhou M, Dong X, Qu J, Gong F, Han Y, et al. (15. 2. 2020). "Epidemiological and clinical characteristics of 99 cases of 2019 novel coronavirus pneumonia in Wuhan, China: a descriptive study". Lancet. 395 (10223): 507–513. doi:10.1016/S0140-6736(20)30211-7. PMC 7135076. PMID 32007143.
  56. ^ Zhang J, Zhou L, Yang Y, Peng W, Wang W, Chen X (februar 2020). "Therapeutic and triage strategies for 2019 novel coronavirus disease in fever clinics". Lancet Respiratory Medicine. 8 (3): e11–e12. doi:10.1016/S2213-2600(20)30071-0. PMC 7159020. PMID 32061335.

Vanjski linkovi[uredi | uredi izvor]

MedlinePlus Encyclopedia: C-reactive protein