C1GALT1

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
C1GALT1
Identifikatori
AliasiC1GALT1
Vanjski ID-jeviOMIM: 610555 MGI: 2151071 HomoloGene: 10599 GeneCards: C1GALT1
Lokacija gena (čovjek)
Hromosom 7 (čovjek)
Hrom.Hromosom 7 (čovjek)[1]
Hromosom 7 (čovjek)
Genomska lokacija za C1GALT1
Genomska lokacija za C1GALT1
Bend7p22.1-p21.3Početak7,156,934 bp[1]
Kraj7,248,616 bp[1]
Ontologija gena
Molekularna funkcija transferase activity, transferring glycosyl groups
transferase activity
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase activity
GO:0001948 protein binding
metal ion binding
Ćelijska komponenta integral component of membrane
Golđijeva membrana
membrana
Biološki proces multicellular organism development
protein glycosylation
Ćelijska diferencijacija
O-glycan processing, core 1
angiogenesis
intestinal epithelial cell development
Nefrogeneza
O-glycan processing
protein O-linked glycosylation
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_020156

NM_052993

RefSeq (bjelančevina)

NP_064541

NP_443719

Lokacija (UCSC)Chr 7: 7.16 – 7.25 Mbn/a
PubMed pretraga[2][3]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš
Jezgrena 1 sintaza, glikoprotein-N-acetilgalaktozamin
3-beta-galaktoziltransferaza, 1
Identifikatori
SimbolC1GALT1
NCBI gen56913
HGNC24337
OMIM610555
RefSeqNM_020156
UniProtQ9NS00
Ostali podaci
EC broj2.4.1.122
LokusHrom. 7 p21.3{{{lokus_dopunski_podaci}}}
Pretraga za
StruktureSwiss-model
DomeneInterPro

Jezgrena 1 sintaza, glikoprotein-N-acetilgalaktozamin 3-beta-galaktoziltransferaza 1, znana i kao C1GALT1, ie enzim koji je kod ljudi kodiran genom C1GALT1.[4][5]

Aminokiselinska sekvenca[uredi | uredi izvor]

1020304050
MASKSWLNFLTFLCGSAIGFLLCSQLFSILLGEKVDTQPNVLHNDPHARH
SDDNGQNHLEGQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNL
EKKAKHVKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIKA
FQYVHEHYLEDADWFLKADDDTYVILDNLRWLLSKYDPEEPIYFGRRFKP
YVKQGYMSGGAGYVLSKEALKRFVDAFKTDKCTHSSSIEDLALGRCMEIM
NVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC
CSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQA
NKNEDTKVKLGNP
Simboli

Funkcija[uredi | uredi izvor]

Obična jezgarna 1 O-glikanska struktura Gal-beta-1-3GalNAc-R je prekursor mnogih struktura O-glikana proširenog mucinskog tipa na površini životinjskih ćelija i izlučenih glikoproteina. Jezgro 1 se sintetizira prenošenjem Gal iz UDP - Gal u GalNAc-alfa-1-R, pomoću jezgra 1 beta-3-galaktoziltransferaze (C1GALT1).[5]

C1GALT1 povezan je sa T-Tn sistemom antigena.[6]

Klinički značaj[uredi | uredi izvor]

Postoje neki dokazi da mutacije u genu C1GALT1 mogu biti povezane sa bolestima bubrega.[7]

Također pogledajte[uredi | uredi izvor]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000106392 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ Amado M, Almeida R, Schwientek T, Clausen H (decembar 1999). "Identification and characterization of large galactosyltransferase gene families: galactosyltransferases for all functions". Biochim. Biophys. Acta. 1473 (1): 35–53. doi:10.1016/S0304-4165(99)00168-3. PMID 10580128.
  5. ^ a b Ju T, Brewer K, D'Souza A, Cummings RD, Canfield WM (januar 2002). "Cloning and expression of human core 1 beta1,3-galactosyltransferase". J. Biol. Chem. 277 (1): 178–86. doi:10.1074/jbc.M109060200. PMID 11677243.
  6. ^ "BGMUT Blood Group Antigen Gene Mutation Database". Pristupljeno 16. 7. 2011.
  7. ^ Alexander WS, Viney EM, Zhang JG, et al. (oktobar 2006). "Thrombocytopenia and kidney disease in mice with a mutation in the C1galt1 gene". Proc. Natl. Acad. Sci. U.S.A. 103 (44): 16442–7. doi:10.1073/pnas.0607872103. PMC 1637601. PMID 17062753.

Vanjski linkovi[uredi | uredi izvor]

Šablon:Glikoziltransferaze