CACTIN

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
CACTIN
Identifikatori
AliasiCACTIN
Vanjski ID-jeviOMIM: 618536 MGI: 1917562 HomoloGene: 69553 GeneCards: CACTIN
Lokacija gena (čovjek)
Hromosom 19 (čovjek)
Hrom.Hromosom 19 (čovjek)[1]
Hromosom 19 (čovjek)
Genomska lokacija za CACTIN
Genomska lokacija za CACTIN
Bend19p13.3Početak3,610,645 bp[1]
Kraj3,626,815 bp[1]
Lokacija gena (miš)
Hromosom 10 (miš)
Hrom.Hromosom 10 (miš)[2]
Hromosom 10 (miš)
Genomska lokacija za CACTIN
Genomska lokacija za CACTIN
Bend10|10 C1Početak81,321,103 bp[2]
Kraj81,326,242 bp[2]
Ontologija gena
Molekularna funkcija GO:0001948 protein binding
RNA binding
Ćelijska komponenta catalytic step 2 spliceosome
Nukleoplazma
spliceosomal complex
Egzosom
Jedro
citosol
nuclear speck
citoplazma
Biološki proces negative regulation of protein phosphorylation
mRNA splicing, via spliceosome
immune system process
negative regulation of type I interferon-mediated signaling pathway
cellular response to tumor necrosis factor
mRNA processing
negative regulation of interferon-beta production
negative regulation of lipopolysaccharide-mediated signaling pathway
multicellular organism development
negative regulation of interleukin-8 production
negative regulation of toll-like receptor signaling pathway
cellular response to interleukin-1
Prerada RNK
negative regulation of tumor necrosis factor production
Urođeni imunski sistem
cellular response to lipopolysaccharide
negative regulation of NF-kappaB transcription factor activity
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001080543
NM_021231

NM_027381

RefSeq (bjelančevina)

NP_001074012
NP_067054

NP_081657

Lokacija (UCSC)Chr 19: 3.61 – 3.63 MbChr 10: 81.32 – 81.33 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Kaktin, znan i kao bubrežni karcinomski antigen NY-REN-24 je protein koji je kod ljudi kodiran genom CACTIN.[5][6][7]

Kaktin je negativni regulator urođene imunske signalizacije i funkcionalna komponenta mehanizma za preradu pre-iRNK

Kloniranje i ekspresija[uredi | uredi izvor]

SEREX-om (serološka analiza biblioteka ekspresije rekombinantne cDNK, skriningom biblioteka cDNK ljudskog karcinoma bubrega, Scanlan et sl. (1999) klonirali CACTIN, koji su označili kao NY-REN-24. RT-PCR analiza otkrila je ekspresiju kaktina u svih šest testiranih ljudskih tkiva: pluća, testisi, tanko crijevo, dojka, jetra i placenta Analiza sekvence sugerira da se CACTIN lokalizira u jedru.[8].[8]

Lin et al. (2000) kloniraki su kaktin Drosophila. Predviđeni protein kaktin Drosophila ima N-terminalni domen bogat napunjenim ostacima, tri potencijalna dvodijelna signala jedarne lokalizacije i tri domena sa spiralnom zavojnicom. Drozofilski kaktin dijeli 41% identiteta aminokiselina s predviđenim ljdskim proteinom CACTIN od 758 aminokiselina. CACTIN je konzerviran u biljkama i životinjama, a svi kaktinski ortolozi imaju visoko konzerviranu regiju u svojim C-terminalnim polovinama. Northern blot analiza pokazala je ekspresiju kaktina kod ženki roda Drosophila , ali samo slabu ekspresiju kod mužjaka. Kod ženki, kaktin je bio prisutan na relativno visokim nivoima u jajnicima i tokom embriogeneze.

Koristeći RT-PCR, Atzei et al. (2010) pokazali su da se kaktin sveprisutno eksprimirao u mozgu i perifernim organima miša Otkrili su i da je kaktin eksprimiran u svim fazama ranog embrionakog razvoja kod zebrica.[9]

Funkcija gena[uredi | uredi izvor]

Korištenjem 2-hibridnih analiza kvasca i koimunoprecipitacije, Lin et al. (2000) otkrili su da je kaktin komunicirao s kaktusom, ortologom I-kappa-B, kod drozofile. Prekomjerna ekspresija kaktina u heterozigotnim drosofilama za mutirani akt kaktin-A2 poboljšala je mutantni fenotip, sa snažnim povećanjem embrionske letalnosti i ventralizacije.[10]

Atzei et al. (2010) otkrili su da je prekomjerna ekspresija ljudskog CACTIN-a inhibirala ćelijsku aktivaciju NFKB, kao odgovor na proinflamatorne podražaje, dok ga je noktadn povećao. Slično tome, CACTIN negativno regulira TLR-posredovanu aktivaciju IRF3 i IRF7 i indukciju gena koji reagiraju na IRF. Analize koimunoprecipitacije i imunofluorescencije pokazale su da CACTIN nije komunicirao s citoplazmatskom IKBA (NFKBIA), već je kolokalizirao i interakciju sa nuklearnim IKBL (NFKBIL1), za koji je utvrđeno da inhibira aktivaciju puteva NFKB i IRF, izazvanih lipopolisaharidima. CACTIN bez svojihjedarnih lokalizacijskih sekvenci bio je isključen iz jdra, nije uspio stupiti u interakciju s IKBL i pokazao je znatno smanjene inhibitorne efekte na TLR signalizaciju.[11]

Suzuki i et al. (2016) otkrili su da su se ljudski CACTIN i TRIM39 (605700) izravno vezali i da je za interakciju potrebna domena B-boka TRIM39. Analiza frakcionacije u ćelijama HEK293T pokazala je da je CACTIN lokaliziran i na jedro i na citosol. TRIM39 je komunicirao s CACTIN-om uglavnom u jezgri kako bi ga stabilizirao na ubikvitinacijski neovisan način..[12]

Daljnje analize pokazale su da je CACTIN pružio petlju negativne povratne sprege u signalnom putu NFKB-a, jer je TRIM39 negativno regulirao aktivnost transkripcije posredovane NFKB-om stabilizirajući CACTIN. Analizom nokdauna, Zanini et al. (2017) pokazali su da je CACTIN bitan za potporu proliferaciji ćelija, stabilnost genoma, pravilni morfologiju jedra i segregaciju hromosoma u ljudskim ćelijama. Analiza sekvencirane RNK otkrila je defekte prerade na hiljadama pre-iRNK u ćelijama osiromašenim kaktinom. Konkretno, na preradu sororina (CDCA5) uticalo se u ćelijama osiromašenim kaktinom, što je rezultiralo akumulacijom neprerađenog pre-iRNK sororina. Ekspresija cDNK bez soroina u različitoj je mjeri obnovila nedostatke povezane sa iscrpljivanjem kactina, što ukazuje da je CACTIN podržavao normalnu koheziju i jrdarnu strukturu hromosoma, uglavnom promovirajući taču preradu pre-iRNK sororina. Masena spektrometrijska analiza i eksperimenti koimunoprecipitacije otkrili su da je CACTIN u fizičkoj i funkcionalnoj interakciji s DHX8 (600396) i SRRM2, vjerovatno u jedru, podržavajući mehanizme za preradu pre-iRNK.[8][12][13]

Aminokiselinska sekvenca[uredi | uredi izvor]

Simboli
1020304050
MGRDTRSRSRSAGRRGRRRQSQSGSRSRSRSHGRRNRRRREDEGRRRRRR
RSRERRSDSEEERWQRSGMRSRSPPRPKWHSRDGSSQSDSGEEQSRGQWA
RRRRRARSWSPSSSASSSASPGRSQSPRAAAAALSQQQSLQERLRLREER
KQQEELMKAFETPEEKRARRLAKKEAKERKKREKMGWGEEYMGYTNTDNP
FGDNNLLGTFIWNKALEKKGISHLEEKELKERNKRIQEDNRLELQKVKQL
RLEREREKAMREQELEMLQREKEAEHFKTWEEQEDNFHLQQAKLRSKIRI
RDGRAKPIDLLAKYISAEDDDLAVEMHEPYTFLNGLTVADMEDLLEDIQV
YMELEQGKNADFWRDMTTITEDEISKLRKLEASGKGPGERREGVNASVSS
DVQSVFKGKTYNQLQVIFQGIEGKIRAGGPNLDMGYWESLLQQLRAHMAR
ARLRERHQDVLRQKLYKLKQEQGVESEPLFPILKQEPQSPSRSLEPEDAA
PTPPGPSSEGGPAEAEVDGATPTEGDGDGDGEGEGEGEAVLMEEDLIQQS
LDDYDAGRYSPRLLTAHELPLDAHVLEPDEDLQRLQLSRQQLQVTGDASE
SAEDIFFRRAKEGMGQDEAQFSVEMPLTGKAYLWADKYRPRKPRFFNRVH
TGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIDKRSTPEYFLEACA
DNKDFAILRFHAGPPYEDIAFKIVNREWEYSHRHGFRCQFANGIFQLWFH
FKRYRYRR

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000105298 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000034889 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Andersson B, Wentland MA, Ricafrente JY, Liu W, Gibbs RA (Jun 1996). "A "double adaptor" method for improved shotgun library construction". Anal Biochem. 236 (1): 107–13. doi:10.1006/abio.1996.0138. PMID 8619474.
  6. ^ Yu W, Andersson B, Worley KC, Muzny DM, Ding Y, Liu W, Ricafrente JY, Wentland MA, Lennon G, Gibbs RA (Jun 1997). "Large-scale concatenation cDNA sequencing". Genome Res. 7 (4): 353–8. doi:10.1101/gr.7.4.353. PMC 139146. PMID 9110174.
  7. ^ "Entrez Gene: C19orf29 chromosome 19 open reading frame 29".
  8. ^ a b c Scanlan, M. J., Gordan, J. D., Williamson, B., Stockert, E., Bander, N. J., Jongeneel, V., Gure, A. O., Jager, D., Jager, E., Knuth, A., Chen, Y.-T., Old, L. J. Antigens recognized by autologous antibody in patients with renal-cell carcinoma. Int. J. Cancer 83: 456-464, 1999. [PubMed]: 10508479
  9. ^ Atzei, P., Gargan, S., Curran, N., Moynagh, P. N. Cactin targets the MHC class III protein I-kappa-B-like (I-kappa-BL) and inhibits NF-kappa-B and interferon-regulatory factor signaling pathways. J. Biol. Chem. 285: 36804-36817, 2010. [PubMed]: 20829348
  10. ^ Lin, P.-H., Huang, L. H., Steward, R. Cactin, a conserved protein that interacts with the Drosophila I-kappa-B protein cactus and modulates its function. Mech. Dev. 94: 57-65, 2000. [PubMed]: 10842059
  11. ^ Atzei, P., Yang, F., Collery, R., Kennedy, B. N., Moynagh, P. N. Characterisation of expression patterns and functional role of cactin in early zebrafish development. Gene Expr. Patterns 10: 199-206, 2010. [PubMed]: 20348034
  12. ^ a b Suzuki, M., Watanabe, M., Nakamaru, Y., Takagi, D., Takahashi, H., Fukuda, S., Hatakeyama, S. TRIM39 negatively regulates the NF-kappa-B-mediated signaling pathway through stabilization of cactin. Cell. Molec. Life Sci. 73: 1085-1101, 2016. [PubMed]: 26363554
  13. ^ Zanini, I. M. Y., Soneson, C., Lorenzi, L. E., Azzalin, C. M. Human cactin interacts with DHX8 and SRRM2 to assure efficient pre-mRNA splicing and sister chromatid cohesion. J. Cell Sci. 130: 767-778, 2017. [PubMed]: 28062851

Dopunska literatura[uredi | uredi izvor]