CARKD

S Wikipedije, slobodne enciklopedije
CARKD
Identifikatori
AliasiNAXD
Vanjski ID-jeviOMIM: 615910 MGI: 1913353 HomoloGene: 6333 GeneCards: NAXD
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za CARKD
Genomska lokacija za CARKD
Bend13q34Početak110,615,545 bp[1]
Kraj110,639,996 bp[1]
Lokacija gena (miš)
Hromosom 8 (miš)
Hrom.Hromosom 8 (miš)[2]
Hromosom 8 (miš)
Genomska lokacija za CARKD
Genomska lokacija za CARKD
Bend8|8 A1.1Početak11,547,506 bp[2]
Kraj11,564,960 bp[2]
Ontologija gena
Molekularna funkcija nucleotide binding
GO:0001948, GO:0016582 protein binding
ATP binding
ADP-dependent NAD(P)H-hydrate dehydratase activity
lyase activity
ATP-dependent NAD(P)H-hydrate dehydratase activity
molecular function
Ćelijska komponenta mitohondrija
mitochondrial matrix
ćelijska komponenta
Biološki proces NAD biosynthesis via nicotinamide riboside salvage pathway
GO:0022610 biološki proces
nicotinamide nucleotide metabolic process
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001242881
NM_001242882
NM_001242883
NM_018210

NM_001190357
NM_001293661
NM_026995

RefSeq (bjelančevina)

NP_001229810
NP_001229811
NP_001229812
NP_060680

NP_001177286
NP_001280590
NP_081271
NP_001389565

Lokacija (UCSC)Chr 13: 110.62 – 110.64 MbChr 8: 11.55 – 11.56 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš
Karbohidratna kinaza
Carbohydrate kinase 1KYH.png
Kristalografska struktura navodne kinaze ugljikohidrata Bacillus subtilis (u boji duge, N-kraj = plava, C-kraj = crvena).[5]
Identifikatori
SimbolCarb_kinase
PfamPF01256
Pfam klanCL0118
InterProIPR000631
PROSITEPDOC00806
SCOP21kyh / SCOPe / SUPFAM
Dostupne proteinske strukture:
Pfam  strukture / ECOD  
PDBRCSB PDB; PDBe; PDBj
PDBsumsažetak strukture
PDB1kyh, 2ax3

Domen ugljikohidratne kinaze koji sadrži protein (skraćeno CARKD), kodiran genom CARKD, je ljudski protein nepoznate funkcije. Gen CARKD kodira proteine s predviđenim mitohondrijskim propeptidom (mCARKD), signalnim peptidom (spCARKD) ili niti jednim od njih (cCARKD). Analiza konfokusne mikroskopije transficiranih CHO (jajnika kineskog hrčka) pokazala je da cCARKD ostaje u citosolu, dok su mCARKD i spCARKD usmjereni na mitohondrije i endoplazmatski retikulum.[6] Protein je konzerviran u mnogim vrstama, sa predvđenim ortolozima do eukariota, bakterija i arheja.

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 347 aminokiselina, a molekulska težina 36.576 Da.[7].

1020304050
MVTRAGAGTAVAGAVVVALLSAALALYGPPLDAVLERAFSLRKAHSIKDM
ENTLQLVRNIIPPLSSTKHKGQDGRIGVVGGCQEYTGAPYFAAISALKVG
ADLSHVFCASAAAPVIKAYSPELIVHPVLDSPNAVHEVEKWLPRLHALVV
GPGLGRDDALLRNVQGILEVSKARDIPVVIDADGLWLVAQQPALIHGYRK
AVLTPNHVEFSRLYDAVLRGPMDSDDSHGSVLRLSQALGNVTVVQKGERD
ILSNGQQVLVCSQEGSSRRCGGQGDLLSGSLGVLVHWALLAGPQKTNGSS
PLLVAAFGACSLTRQCNHQAFQKHGRSTTTSDMIAEVGAAFSKLFET
Simboli

Struktura[uredi | uredi izvor]

Gen[uredi | uredi izvor]

Ljudski gen CARKD ima 10 egzona i nalazi se na poziciji q34 hromosoma 13. Sljedeći geni su blizu CARKD -a na hromosomu:[8]

  • COL4A2: za A2 podjedinicu kolagena tipa IV
  • RAB20: Potencijalni regulator prometa koneksina 43.
  • CARS2: za mitohondrijsku cistienil-tRNK sintetazu 2
  • ING1: za protein koji potiskuje tumore

Protein[uredi | uredi izvor]

Ovaj protein je dio natporodice fosfometilpirimidin-kinaza: ribokinaza / pfkB. Ovu porodicu karakterizira prisutnost domena koju dijeli porodica.[9] CARKD sadrži domen karbohidratne kinaze porodice PF01256.[9] Ova porodica je u srodstvu sa porodicama PF02210 i PF00294, što implicira da je to također ugljikohidrat-kinaza.

Predviđena svojstva[uredi | uredi izvor]

Pomoću bioinformatičkih analiza, predviđena su sljedeća svojstva CARKD-a:

Funkcija[uredi | uredi izvor]

Tkivna distribucija[uredi | uredi izvor]

Čini se da je CARKD sveprisutno eksprimiran na visokim nivoima. Podaci o ekspresiji u ljudskom proteinu i mišjeg ortologa ukazuju na njegovu ekspresiju u gotovo svim tkivima.[14][15] Jedan osebujan obrazac ekspresije CARKD -a je različito ispoljavanje tokom razvoja oligodendrocita. Njegova ekspresija je niža u matičnim ćelijama oligodendrocita nego u zrelim oligodendrocitima.[16]

Vezujući partneri[uredi | uredi izvor]

Predviđeno je da je partner za vezivanje za CARKD, prekursor apolipoproteina A-1 ljudskih proteina (APOA1BP).[17] Ovo predviđanje temelji se na istovremenoj pojavi u genomima i koekspresiji. Osim ovih podataka, ortolozi CARKD -a u Escherichia coli sadrže domen sličan APOA1BP-u. Ovo ukazuje na to da su dva proteina vjerojatno nastala od zajedničkog evolucijskog pretka i, prema teoriji analize kamena rozeta, [18] mogući su partneri u interakciji čak i kod vrsta poput ljudi, gdje se dva proteina ne proizvode kao jedan polipeptid.

Klinički značaj[uredi | uredi izvor]

Na osnovu alela specifične ekspresije CARKD-a, CARKD može imati ulogu u akutnoj limfoblastnoj leukemiji.[19] Osim toga, mikročipni podaci pokazuju da je CARKD reguliran prema gore u tumorima glioblastoma multiforme.[20]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000213995 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000031505 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ PDB 1kyh; Zhang RG, Grembecka J, Vinokour E, Collart F, Dementieva I, Minor W, Joachimiak A (September 2002). "Structure of Bacillus subtilis YXKO--a member of the UPF0031 family and a putative kinase". Journal of Structural Biology. 139 (3): 161–70. doi:10.1016/S1047-8477(02)00532-4. PMC 2793413. PMID 12457846.
  6. ^ Marbaix, AY; Tyteca, D; Niehaus, TD; Hanson, AD; Linster, CL; Van Schaftingen, E (15 May 2014). "Occurrence and subcellular distribution of the NADPHX repair system in mammals". The Biochemical Journal. 460 (1): 49–58. doi:10.1042/bj20131482. PMID 24611804.
  7. ^ "UniProt, Q8IW45". Pristupljeno 2017-09-11. CS1 održavanje: nepreporučeni parametar (link)
  8. ^ "UCSC Genome Browser: CARKD".
  9. ^ a b "CDD: Conserved Domain Database (NCBI)".
  10. ^ Brendel V, Bucher P, Nourbakhsh IR, Blaisdell BE, Karlin S (March 1992). "Methods and algorithms for statistical analysis of protein sequences". Proceedings of the National Academy of Sciences of the United States of America. 89 (6): 2002–6. doi:10.1073/pnas.89.6.2002. PMC 48584. PMID 1549558.
  11. ^ a b "PI Program (Isoelectric Point Prediction)". Arhivirano s originala, 2008-10-26.
  12. ^ a b "UniProt Database".
  13. ^ Bendtsen JD, Nielsen H, Gunnar vH (July 2004). "Improved prediction of signal peptides: SignalP 3.0". Journal of Molecular Biology. 340 (4): 783–95. CiteSeerX 10.1.1.165.2784. doi:10.1016/j.jmb.2004.05.028. PMID 15223320. Zanemaren tekst "von Heijne G, Brunak S" (pomoć); Greška u vankuverskom stilu: initials u nazivu 3 (pomoć)
  14. ^ "Unigene (EST profile viewer) Human CARKD".
  15. ^ "Unigene (EST profile viewer) Mouse CARKD".
  16. ^ Nielsen JA, Maric D, Lau P, Barker JL, Hudson LD (September 2006). "Identification of a novel oligodendrocyte cell adhesion protein using gene expression profiling". Journal of Neuroscience. 26 (39): 9881–91. doi:10.1523/JNEUROSCI.2246-06.2006. PMC 1613258. PMID 17005852.
  17. ^ "STRING: Known and Predicted Protein-Protein Interactions".
  18. ^ Date SV (2008). The Rosetta stone method. Methods Mol Biol. Methods in Molecular Biology™. 453. str. 169–80. doi:10.1007/978-1-60327-429-6_7. ISBN 978-1-60327-428-9. PMID 18712302.
  19. ^ Milani L, Lundmark A, Nordlund J, Kiialainen A, Flaegstad T, Jonmundsson G, Kanerva J, Schmiegelow K, Gunderson KL, Lönnerholm G, Syvänen AC (January 2009). "Allele-specific gene expression patterns in primary leukemic cells reveal regulation of gene expression by CpG site methylation". Genome Research. 19 (1): 1–11. doi:10.1101/gr.083931.108. PMC 2612957. PMID 18997001.
  20. ^ Ruano Y, Mollejo M, Ribalta T, Fiaño C, Camacho FI, Gómez E, de Lope AR, Hernández-Moneo JL, Martínez P, Meléndez B (2006). "Identification of novel candidate target genes in amplicons of Glioblastoma multiforme tumors detected by expression and CGH microarray profiling". Molecular Cancer. 5 (1): 39. doi:10.1186/1476-4598-5-39. PMC 1592108. PMID 17002787.

Vanjski linkovi[uredi | uredi izvor]