CKAP2

S Wikipedije, slobodne enciklopedije
CKAP2
Identifikatori
AliasiCKAP2
Vanjski ID-jeviOMIM: 611569 MGI: 1931797 HomoloGene: 10070 GeneCards: CKAP2
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za CKAP2
Genomska lokacija za CKAP2
Bend13q14.3Početak52,455,429 bp[1]
Kraj52,476,628 bp[1]
Lokacija gena (miš)
Hromosom 8 (miš)
Hrom.Hromosom 8 (miš)[2]
Hromosom 8 (miš)
Genomska lokacija za CKAP2
Genomska lokacija za CKAP2
Bend8|8 A2Početak22,658,176 bp[2]
Kraj22,675,835 bp[2]
Obrazac RNK ekspresije
PBB GE CKAP2 218252 at fs.png
Više referentnih podataka o ekspresiji
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001098525
NM_001286686
NM_001286687
NM_018204

NM_001004140

RefSeq (bjelančevina)

NP_001091995
NP_001273615
NP_001273616
NP_060674

NP_001004140

Lokacija (UCSC)Chr 13: 52.46 – 52.48 MbChr 8: 22.66 – 22.68 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Citoskeletno pridruženi protein 2 je protein koji je kod ljudi kodiran genom CKAP2.[5][6]

Metodom fluorescentne hibridizacije in situ, Maouche-Chretien et al. (1998) mapirali su gen CKAP2 na heomosomu 13, sekvenca 13q14.[7]

Ljudski gen CKAP2, čija je cDNK poznata kao LB1, je protein povezan sa citoskelet om, uključen u progresiju mitoze. Njegova visoka transkripcijska aktivnost primijećena je u sjemenicia, timusu i difuznim B-ćelijskim limfomima. Gen kodira protein od 683 ostatka, kojem nedostaje homologija za poznate aminokiselinske sekvence. Na osnovu analize imunofluorescencije, proizvod CKAP2 je citoplazmatski protein, povezan sa citoskeletnim vlaknima.

Preuređenja regije 13q14 rezultiraju različitim tumorima. Tako su otkrivene delecije u multimplim mijelomima, rak prostate, karcinom pločastih ćelija glave i vrata, prolimfocitna leukemija B-ćelija, ne-Hodgkinov limfom, t u više od polovine slučajeva hronične limfocitne leukemije B-ćelija.

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 683 aminokiseline, a molekulska težina 76.987 Da.[8].

1020304050
MSTPAVPQDLQLPPSQRAQSAFKEQRRQKLKEHLLRRKTLFAYKQENEML
SSSRDQRVVTSEDQVQEGTKVLKLKTKMADKENMKRPAESKNNTVVGKHC
IPLKPSNELTNSTVVIDTHKPKDSNQTPHLLLTEDDPQSQHMTLSQAFHL
KNNSKKKQMTTEKQKQDANMPKKPVLGSYRGQIVQSKINSFRKPLQVKDE
SSAATKKLSATIPKATKPQPVNTSSVTVKSNRSSNMTATTKFVSTTSQNT
QLVRPPIRSHHSNTRDTVKQGISRTSANVTIRKGPHEKELLQSKTALSSV
KTSSSQGIIRNKTLSRSIASEVIARPASLSNDKLMEKSEPVDQRRHTAGK
AIVDSRSAQPKETSEERKARLSEWKAGKGRVLKRPPNSVVTQHEPAGQNE
KPVGSFWTTMAEEDEQRLFTEKVNNTFSECLNLINEGCPKEDILVTLNDL
IKNIPDAKKLVKYWICLALIEPITSPIENIIAIYEKAILAGAQPIEEMRH
TIVDILTMKSQEKANLGENMEKSCASKEEVKEVSIEDTGVDVDPEKLEME
SKLHRNLLFQDCEKEQDNKTKDPTHDVKTPNTETRTSCLIKYNVSTTPYL
QSVKKKVQFDGTNSAFKELKFLTPVRRSRRLQEKTSKLPDMLKDHYPCVS
SLEQLTELGRETDAFVCRPNAALCRVYYEADTT
Simboli

Kloniranje i ekspresija[uredi | uredi izvor]

Diferencijalnim skriningom difuznih velikih B-ćelijskih limfoma, nakon čega slijedi analiza baze podataka, RT-PCR i skrining ljudskih Jurkat T-ćelijske cDNK biblioteke, Maouche-Chretien et al. (1998) klonirali su CKAP2, koji su nazvali LB1. Transkript sadrži dva konsenzusna signala poliadenilacije i motiv destabilizacije iRNK bogat parom AU. Izvedeni protein od 683 aminokiseline ima domen bogat leucinom i izoleucinom i brojna potencijalna mjesta fosforilacije. Northern blot analiza otkrila je varijabilnu ekspresiju velikog transkripta od 3,6 do 3,9 kb i manjeg transkripta od 2,2 kb u svim ispitivanim ljudskim tkivima i ćelijskim linijama. Transkripcija/translacija in vitro proizvela je protein s prividnom molekulskom masom od 85 kD, pomoću SDS-PAGE. Imunofluorescentna analiza transficiranih COS ćelikjaa pokazala je da je epitop označen CKAP2 lokaliziran u citoplazmatskim citoskeletnim filamentima.

Diferencijalnim prikazom-PCR primarnih ljudskih adenokarcinoma želuca, nakon čega slijede 5-prim i 3-prim RACE, Bae et al. (2003) klonirali su CKAP2 pune dužine i kraću varijantu, CKAP2S, koja je rezultat alternativne prerade u egzonu 6. CKAP2 protein pune dužine sadrži 682 aminokiseline, a protein CKAP2S 494 aminokiseline. Northern blot analiza pokazala je da je ekspresija CKAP2 veća u mozgu, timusu, bubrezima i posteljici nego u srcu, skeletnim mišićima, plućima, leukocitima i gastrointestinalnom traktu. Drugi, manji transkript otkriven je u tkivima sa visokom ekspresijom CKAP2. Endogeni CKAP2 i CKAP2 označeni fluorescencijom povezani sa centrom za organizaciju mikrotubula i s mikrotubulama u HeLa ćelijama, a ova lokalizacija je izgubljena nakon tretmana sredstvom za destabilizaciju mikrotubula. Western blot analiza otkrila je endogeni CKAP2 pri prividnoj molekulskoj masi od 75 kD.

Funkcija gena[uredi | uredi izvor]

Maouche-Chretien et al (1998) otkrili su da je ekspresija LB1 povećana kod pacijenata sa imunoblastnim podtipom difuznog velikog B-ćelijskog limfoma i kod pacijenata sa multilobiranim centroblastičnim podtipom difuznog velikog B-ćelijskog limfoma. Nasuprot tome, ekspresija je bila niska ili se nije mogla otkriti u črtiri pacijenta s polimorfnim centroblastnim difuznim velikim B-ćelijskim limfomima.

Koristeći testove zaštite ribonukleazama i RT-PCR, Bae et al. (2003) otkrili su da je ekspresija CKAP2 i CKAP2S povećana u tkivima želuca u usporedbi s odgovarajućom normalnom sluznicom. Imunohistohemijska analiza nije otkrila protein CKAP2 u normalnoj sluznici želuca, ali je otkriven u svim pregledanim adenokarcinomima želuca i tubulnim adenomima.[9]

Jeon et al. (2006) otkrili su da CKAP2 nije eksprimiran u fibroblastima ljudskom prepucija koji su zaustavljeni G0/G1-fazi, već da je eksprimiran u ćelijama koje se aktivno dijele, postupno povećavajući između kasnih G1 i G2/M-faza. Razgradnja CKAP2 smanjila je fosforilaciju RB1 i povećalo ekspresiju p27 (CDKN1B), a posljedično je smanjila i proliferaciju ćelija, dok je konstitutivna ekspresija CKAP2 povećala fosforilaciju RB i povećala proliferaciju.[10]

Kompleks/ciklosom koji podstiče anafazu (APC/C) je ubikvitinska ligaza, koja kontrolira odvajanje sestrinske hromatide i izlaz iz mitoze. Prepoznaje dva motiva na svojim podlogama: kutiju za uništavanje (D) i kutiju za KEN. Seki i Fang (2007) otkrili su da je CKAP2 razgrađen pomoću CDH1 i aktiviranog APC/C u ekstraktima Xenopus interfaze, ali ne i u mitotskim ekstraktima. CKAP2 sadrži četiri D-kutije i KEN-kutiju, a analiza mutacije pokazala je da je samo KEN kutija bila potrebna za sveprisutnu primjenu APC/C-CDH1 i razgradnju u međufaznim ekstraktima aktiviranim CDH1. Prekomjerna ekspresija CDH1 u HeLa ćelijama smanjila je nivoe CKAP2 na način ovisan od KEN kutije, dok je oborenje CDH1 povećalo poluvrijeme eliminacije CKAP2. CKAP2 povezan s centrosomskim mikrotubulama u kasnoj G2-fazi u HeLa ćelija, ali tek nakon razdvajanja dupliciranih centrosoma. Tokom mitoze, CKAP2 se povezivao sa polopvima vretena i sa mikrotubulama vretena iz profaze, tokom anafaze i nestao je iz mikrotubula tokom citokineze. Razgradnja CKAP2 nije promijenila distribuciju ćelijskog ciklusa u ćelijama, niti je generiralo mitotske efekte. S druge strane, ektopska ekspresija CKAP2 divljeg tipa ili nerazgradivog CKAP2 mutanta dovela je do mitoskog zaustavljanja s monopolarnim vretenima, koja sadrže visoko usnopljene mikrotubule. Zaključili su da je regulacija CKAP2 pomoću APC/C kritična za normalnu progresiju mitoze.[11]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000136108 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000037725 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Maouche-Chretien L, Deleu N, Badoual C, Fraissignes P, Berger R, Gaulard P, Romeo PH, Leroy-Viard K (Oct 1998). "Identification of a novel cDNA, encoding a cytoskeletal associated protein, differentially expressed in diffuse large B cell lymphomas". Oncogene. 17 (10): 1245–51. doi:10.1038/sj.onc.1202048. PMID 9771967.
  6. ^ "Entrez Gene: CKAP2 cytoskeleton associated protein 2".
  7. ^ Maouche-Chretien, L., Deleu, N., Badoual, C., Fraissignes, P., Berger, R., Gaulard, P., Romeo, P. H., Leroy-Viard, K. Identification of a novel cDNA, encoding a cytoskeletal associated protein, differentially expressed in diffuse large B cell lymphomas. Oncogene 17: 1245-1251, 1998. PubMed: 9771967
  8. ^ "UniProt, Q8WWK9". Pristupljeno 2017-09-11. CS1 održavanje: nepreporučeni parametar (link)
  9. ^ Bae, C.-D., Sung, Y.-S., Jeon, S.-M., Suh, Y., Yang, H.-K., Kim, Y. I., Park, K.-H., Choi, J., Ahn, G., Park, J. Up-regulation of cytoskeletal-associated protein 2 in primary human gastric adenocarcinomas. J. Cancer Res. Clin. Oncol. 129: 621-630, 2003. PubMed: 12942315
  10. ^ Jeon, S.-M., Choi, B., Hong, K. U., Kim, E., Seong, Y.-S., Bae, C.-D., Park, J. A cytoskeleton-associated protein, TMAP/CKAP2, is involved in the proliferation of human foreskin fibroblasts. Biochem. Biophys. Res. Commun. 348: 222-228, 2006. Note: Erratum: Biochem. Biophys. Res. Commun. 354: 839 only, 2007. PubMed: 16876122
  11. ^ Seki, A., Fang, G. CKAP2 is a spindle-associated protein degraded by APC/C-Cdh1 during mitotic exit. J. Biol. Chem. 282: 15103-15113, 2007. PubMed: 17376772

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]