Idi na sadržaj

CLCN7

S Wikipedije, slobodne enciklopedije
CLCN7
Identifikatori
AliasiCLCN7
Vanjski ID-jeviOMIM: 602727 MGI: 1347048 HomoloGene: 56546 GeneCards: CLCN7
Lokacija gena (čovjek)
Hromosom 16 (čovjek)
Hrom.Hromosom 16 (čovjek)[1]
Hromosom 16 (čovjek)
Genomska lokacija za CLCN7
Genomska lokacija za CLCN7
Bend16p13.3Početak1,444,934 bp[1]
Kraj1,475,084 bp[1]
Lokacija gena (miš)
Hromosom 17 (miš)
Hrom.Hromosom 17 (miš)[2]
Hromosom 17 (miš)
Genomska lokacija za CLCN7
Genomska lokacija za CLCN7
Bend17 A3.3|17 12.53 cMPočetak25,352,365 bp[2]
Kraj25,381,078 bp[2]
Obrazac RNK ekspresije




Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija nucleotide binding
ion channel activity
antiporter activity
ATP binding
chloride channel activity
voltage-gated chloride channel activity
GO:0001948, GO:0016582 vezivanje za proteine
chloride transmembrane transporter activity
GO:0022891 transmembrane transporter activity
Ćelijska komponenta integral component of membrane
Lizozom
GO:0016023 citoplazmatska vezikula
lysosomal membrane
membrana
nukleoplazma
intracellular membrane-bounded organelle
Biološki proces ion transmembrane transport
chloride transport
ion transport
regulation of anion transmembrane transport
response to pH
transmembrane transport
chloride transmembrane transport
GO:0015915 transport
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001114331
NM_001287

NM_011930
NM_001317404

RefSeq (bjelančevina)

NP_001107803
NP_001278

NP_001304333
NP_036060

Lokacija (UCSC)Chr 16: 1.44 – 1.48 MbChr 17: 25.35 – 25.38 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Podjedinica alfa hlornog kanala 7, znana i kao H+/Cl razmjenski transporter 7 jest protein koji je kod ljudi kodiran genom CLCN7 sa hromosoma 7.[5]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 805 aminokiselina, a molekulska težina 88.679 Da.[6]

1020304050
MANVSKKVSWSGRDRDDEEAAPLLRRTARPGGGTPLLNGAGPGAARQSPR
SALFRVGHMSSVELDDELLDPDMDPPHPFPKEIPHNEKLLSLKYESLDYD
NSENQLFLEEERRINHTAFRTVEIKRWVICALIGILTGLVACFIDIVVEN
LAGLKYRVIKGNIDKFTEKGGLSFSLLLWATLNAAFVLVGSVIVAFIEPV
AAGSGIPQIKCFLNGVKIPHVVRLKTLVIKVSGVILSVVGGLAVGKEGPM
IHSGSVIAAGISQGRSTSLKRDFKIFEYFRRDTEKRDFVSAGAAAGVSAA
FGAPVGGVLFSLEEGASFWNQFLTWRIFFASMISTFTLNFVLSIYHGNMW
DLSSPGLINFGRFDSEKMAYTIHEIPVFIAMGVVGGVLGAVFNALNYWLT
MFRIRYIHRPCLQVIEAVLVAAVTATVAFVLIYSSRDCQPLQGGSMSYPL
QLFCADGEYNSMAAAFFNTPEKSVVSLFHDPPGSYNPLTLGLFTLVYFFL
ACWTYGLTVSAGVFIPSLLIGAAWGRLFGISLSYLTGAAIWADPGKYALM
GAAAQLGGIVRMTLSLTVIMMEATSNVTYGFPIMLVLMTAKIVGDVFIEG
LYDMHIQLQSVPFLHWEAPVTSHSLTAREVMSTPVTCLRRREKVGVIVDV
LSDTASNHNGFPVVEHADDTQPARLQGLILRSQLIVLLKHKVFVERSNLG
LVQRRLRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQ
EASLPRVFKLFRALGLRHLVVVDNRNQVVGLVTRKDLARYRLGKRGLEEL
SLAQT

Funkcija[uredi | uredi izvor]

U melanocitnim ćelijama ovaj gen je reguliran mikroftalmijom pridruženim transkripcijskim faktorom.[7][8]

Klinički značaj[uredi | uredi izvor]

Prijavljeno je da su mutacije u genu CLCN7 povezane s autosomno dominantnom osteopetrozom tipom II, rijetkom bolešću kostiju.[9]

Također pogledajte[uredi | uredi izvor]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000103249 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000036636 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: CLCN7 chloride channel 7".
  6. ^ "UniProt, P51798" (jezik: engleski). Pristupljeno 14. 1. 2022.
  7. ^ Meadows NA, Sharma SM, Faulkner GJ, Ostrowski MC, Hume DA, Cassady AI (2007). "The expression of Clcn7 and Ostm1 in osteoclasts is coregulated by microphthalmia transcription factor". J. Biol. Chem. 282 (3): 1891–904. doi:10.1074/jbc.M608572200. PMID 17105730.
  8. ^ Hoek KS, Schlegel NC, Eichhoff OM, Widmer DS, Praetorius C, Einarsson SO, Valgeirsdottir S, Bergsteinsdottir K, Schepsky A, Dummer R, Steingrimsson E (2008). "Novel MITF targets identified using a two-step DNA microarray strategy". Pigment Cell Melanoma Res. 21 (6): 665–76. doi:10.1111/j.1755-148X.2008.00505.x. PMID 19067971. S2CID 24698373.
  9. ^ Coudert AE, Del Fattore A, Baulard C, Olaso R, Schiltz C, Collet C, Teti A, de Vernejoul MC (2014). "Differentially expressed genes in autosomal dominant osteopetrosis type II osteoclasts reveal known and novel pathways for osteoclast biology" (PDF). Lab. Invest. 94 (3): 275–85. doi:10.1038/labinvest.2013.140. PMID 24336069. S2CID 5097233.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]

Ovaj članak uključuje tekst iz Nacionalne medicinske biblioteke Sjedinjenih Država, koji je u javnom vlasništvu.