CLIC4

S Wikipedije, slobodne enciklopedije
CLIC4
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2AHE, 2D2Z, 3OQS

Identifikatori
AliasiCLIC4
Vanjski ID-jeviOMIM: 606536 MGI: 1352754 HomoloGene: 8490 GeneCards: CLIC4
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za CLIC4
Genomska lokacija za CLIC4
Bend1p36.11Početak24,745,382 bp[1]
Kraj24,844,321 bp[1]
Lokacija gena (miš)
Hromosom 4 (miš)
Hrom.Hromosom 4 (miš)[2]
Hromosom 4 (miš)
Genomska lokacija za CLIC4
Genomska lokacija za CLIC4
Bend4|4 D3Početak134,941,280 bp[2]
Kraj135,000,125 bp[2]
Obrazac RNK ekspresije




Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija voltage-gated ion channel activity
GO:0001948, GO:0016582 protein binding
glutathione transferase activity
chloride channel activity
Ćelijska komponenta citoplazma
integral component of membrane
citosol
centrosom
membrana
cell-cell junction
nuclear matrix
microtubule cytoskeleton
Ćelijska membrana
apical part of cell
intracellular anatomical structure
chloride channel complex
centar organizacije mikrotubula
microvillus
cell surface
međućelijske veze
midbody
mitohondrija
actin cytoskeleton
perinuklearno područje citoplazme
Egzosom
citoskelet
cytoplasmic vesicle membrane
GO:0016023 citoplazmatska vezikula
Jedro
Biološki proces cellular response to calcium ion
Ćelijska diferencijacija
multicellular organism growth
regulation of ion transmembrane transport
endothelial cell morphogenesis
ion transport
keratinocyte differentiation
vacuolar acidification
negative regulation of cell migration
oplodnja
establishment or maintenance of apical/basal cell polarity
chloride transport
branching morphogenesis of an epithelial tube
retina vasculature morphogenesis in camera-type eye
regulation of cytoskeleton organization
Angiogeneza
glutathione metabolic process
chloride transmembrane transport
GO:0015915 transport
ion transmembrane transport
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_013943

NM_013885

RefSeq (bjelančevina)

NP_039234

NP_038913

Lokacija (UCSC)Chr 1: 24.75 – 24.84 MbChr 4: 134.94 – 135 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Unutarćelijski hlorni kanal 4, znan i kao CLIC4, jest eukariotski gen koji se kod ljudi nalazi na hromosomu 1.[5]

Amiokiselininska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 253 aminokiseline, a molekulska težina 28.772 Da.[6]

1020304050
MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGV
VFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLC
PPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQK
LDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKV
VAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKR
LTK

Funkcija[uredi | uredi izvor]

Hlorni kanali su raznolika grupa proteina koji regulišu fundamentalne ćelijske procese, uključujući stabilizaciju potencijala ćelijske membrane, transepitelni transport, održavanje unutarćelijskog pH i regulaciju volumena ćelije. Protein klornog unutarćelijskog kanala 4 (CLIC4), kodiran genom CLIC4, član je porodice p64; gen je eksprimiran u mnogim tkivima i pokazuje unutarćelijski vezikulski obrazac u PANC-1 ćelijama (ćelije raka gušterače).[5]

Vezujući partneri[uredi | uredi izvor]

CLIC4 se vezuje za dinamin I, α-tubulin, β-aktin, kreatin-kinazu i dvije 14-3-3 izoforme.[7]

Također pogledajte[uredi | uredi izvor]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000169504 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000037242 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b "Entrez Gene: CLIC4 chloride intracellular channel 4".
  6. ^ "UniProt, Q9Y696" (jezik: engleski). Pristupljeno 23. 11. 2021.
  7. ^ Suginta W, Karoulias N, Aitken A, Ashley RH (oktobar 2001). "Chloride intracellular channel protein CLIC4 (p64H1) binds directly to brain dynamin I in a complex containing actin, tubulin and 14-3-3 isoforms". Biochem. J. 359 (Pt1): 55–64. doi:10.1042/0264-6021:3590055. PMC 1222121. PMID 11563969.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]

Ovaj članak uključuje tekst iz Nacionalne medicinske biblioteke Sjedinjenih Država, koji je u javnom vlasništvu.