EDNRB

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
EDNRB
Identifikatori
AliasiEDNRB
Vanjski ID-jeviOMIM: 131244 MGI: 102720 HomoloGene: 89 GeneCards: EDNRB
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za EDNRB
Genomska lokacija za EDNRB
Bend13q22.3Početak77,895,481 bp[1]
Kraj77,975,529 bp[1]
Lokacija gena (miš)
Hromosom 14 (miš)
Hrom.Hromosom 14 (miš)[2]
Hromosom 14 (miš)
Genomska lokacija za EDNRB
Genomska lokacija za EDNRB
Bend14 E2.3|14 53.05 cMPočetak104,052,061 bp[2]
Kraj104,081,838 bp[2]
Obrazac RNK ekspresije
PBB GE EDNRB 204273 at fs.png

PBB GE EDNRB 204271 s at fs.png

PBB GE EDNRB 206701 x at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija endothelin receptor activity
G protein-coupled receptor activity
signal transducer activity
peptide hormone binding
GO:0001948, GO:0016582 protein binding
type 1 angiotensin receptor binding
Ćelijska komponenta integral component of membrane
Jedarna membrana
membrana
integral component of plasma membrane
Lipidni splav
Ćelijska membrana
Biološki proces enteric smooth muscle cell differentiation
negative regulation of adenylate cyclase activity
positive regulation of protein phosphorylation
peripheral nervous system development
positive regulation of renal sodium excretion
GO:1904578 response to organic cyclic compound
regulation of sensory perception of pain
positive regulation of urine volume
Vazokonstrikcija
positive regulation of cytosolic calcium ion concentration
epithelial fluid transport
GO:0010260 Starenje
Vazodilatacija
negative regulation of apoptotic process
GO:1901227 negative regulation of transcription by RNA polymerase II
cGMP-mediated signaling
regulation of fever generation
nervous system development
regulation of blood pressure
phospholipase C-activating G protein-coupled receptor signaling pathway
cell surface receptor signaling pathway
enteric nervous system development
vein smooth muscle contraction
response to lipopolysaccharide
macrophage chemotaxis
response to pain
neural crest cell migration
positive regulation of cell population proliferation
posterior midgut development
developmental pigmentation
pigmentation
sensory perception of pain
negative regulation of neuron maturation
positive regulation of penile erection
regulation of epithelial cell proliferation
melanocyte differentiation
cellular response to lipopolysaccharide
regulation of pH
GO:0072468 signal transduction
endothelin receptor signaling pathway
calcium-mediated signaling
G protein-coupled receptor signaling pathway
response to endothelin
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_000115
NM_001122659
NM_001201397
NM_003991

NM_001136061
NM_001276296
NM_007904

RefSeq (bjelančevina)

NP_000106
NP_001116131
NP_001188326
NP_003982

NP_001129533
NP_001263225
NP_031930

Lokacija (UCSC)Chr 13: 77.9 – 77.98 MbChr 14: 104.05 – 104.08 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Endotelinski receptor tip B, znan i kao ETB, je protein koji je kod ljudi kodiran genom EDNRB, koji je lociran na hromosomu 13, sekvenca 13q22.3: start 77,895,481 bp kraj 77,975.529 bp.[5]

Arai et al. (1993) pokazali su da ljudski genom sadrži jednu kopiju gena ETRB, koji se prostire na 24 kb i sadrži sedam egzona i šest introna. Svaki intron nalazi se blizu granice pretpostavljenog transmebranskog domena u kodirajućoj regiji.

Koristeći somatske hibridne ćelijske linije čovjek/glodar, locirali su gen ETRB na ljudskom hromosomu 13.[6]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 442 aminokiseline, a molekulska težina 49.644 Da.[7]

1020304050
MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPT
KTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETF
KYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLH
IVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRY
RAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGS
YLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEM
LRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLY
NQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSC
LCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS
Simboli

Kloniranje i ekspresija[uredi | uredi izvor]

Endotelini pripadaju porodici moćnih vazoaktivnih peptida koji se sastoji od tri izopeptida, ET1 (EDN1), ET2 (EDN2) i ET3 (EDN3). Peptidi iz porodice endotelina vrše raznolik skup farmakoloških aktivnosti s različitim potencijama, što ukazuje na postojanje podtipova receptora ET. Takayanagi et al. (1991) opisali su dvije različite podklase ET receptora: specifične za ET1 i ET-neselektivne. Vane (1990) je preporučio da se tip specifičan za ET1 naziva ETA, a neselektivni tip ETB. Nakamuta et al. (1991) izolirali su cDNK koja kodira ljudski ETB receptor iz biblioteke cDNK izgrađene od ljudske jetre. Hepatociti imaju značajan broj ET receptora povezanih s biološkim djelovanjem, poput glikogenolize. cDNK imala je otvoreni okvir čitanja, koji kodira protein od 442 aminokiselinska ostatka, s relativnom masom od 49.643. Zaključena aminokiselinska sekvenca ljudskog ETB receptora bila je 88%, odnosno 64% identična sekvenci ETB receptora pacovskih pluća i ET1-receptora specifičnih za goveđa pluća. Ogawa et al. (1991) također su izolirali neisopeptid-selektivne ljudske endotelinske receptore iz biblioteke cDNK ljudskih posteljica. Predviđeni protein imao je 442 aminokiseline sa transmembranskom topologijom sličnom onoj kod drugih receptora vezanih za G-protein.

Elshourbagy et al. (1996.) izolirali su novu varijantu prerade endotelin-B receptora koju su nazvali ETB-SVR. Sekvenca receptora ETB-SVR identična je ETRB-u, osim za unutarćelijski C-terminalni domen. ETB-SVR receptor je eksprimiran kao iRNK od 2,7 kb u plućima, posteljici, bubrezima i skeletnim mišićima.

Funkcija[uredi | uredi izvor]

Endotelinski receptor tipa B je receptor vezan za G-protein, koji aktivira sistem drugog glasnika fosfatidilinozitol-kalcija. Njegov ligand, endotelin, sastoji se od porodice od tri snažna vazoaktivna peptida: ET1, ET2 i ET3. Opisana je varijanta prerade, zvana SVR; sekvenca receptora ETB-SVR identična je ETRB-u, osim za unutarćelijsku C-terminalni domen. Dok obje varijante prerade vežu ET1, one pokazuju različite reakcije na vezivanje što sugerira da se one mogu funkcionalno razlikovati.[8]

Elshourbagy et al. (1996) transficirali su COS ćelije ETB-SVR ili ETRB i otkrili da se oba receptora vežu za ET1. Međutim, dok su ćelije transficirane ETRB reagirale na ET1 povećanjem akumulacije inozitol-fosfata i unutarćelijskim zakiseljavanjem, transficirane ćelije ETB-SVR nisu pokazale niti jedan od ovih odgovora na ET1. Ovi podaci sugeriraju da su ETB-SVR i ETRB funkcionalno različiti, te da razlika u C-terminalnim aminokiselinskim sekvencama određuje funkcionalnu spregu.

Da bi istražili utjecaj hormonskog okruženja specifičnog za trudnoću na ekspresiju receptora ET1 i ET1 (EDNRA), Bourgeois et al. (1997) istraživali su može li mišićni sloj krvnih žila matičnih resica biti mjesto ekspresije ET1. Autori su otkrili da su, dok su i EDNRA i EDNRB prisutni u krvnim sudovima matičnih resica, ćelije glatkih mišića posteljice isključivo eksprimiraju EDNRA. Maggi et al. (2000) pokazali su da u ćelijama FNC-B4, koje su izvedene iz olfaktornog epitela ljudskog fetusa, i spolni steroidi i mirisi regulišu lučenje GnRH. Otkrili su biološku aktivnost EDN1 u ovoj neuronskoj ćeliji koja luči GnRH. In situ hibridizacija i imunohistohemija otkrili su ekspresiju gena i proteina EDN1 i njegovog konvertirajućeg enzima (ECE1) u fetusnoj olfaktornoj sluznici i ćelijama FNC-B4. Eksperimenti sa radioaktivno označenim EDN1 i EDN3 snažno su ukazali na prisustvodvije klase vezivnih mjesta, što odgovara ETA (16.500 mjesto/ćelija) i ETB receptorima (8.700 mjesto/ćelija). Funkcionalne studije koje su koristile selektivne analoge pokazale su da ove dvije klase receptora služe različitim funkcijama u ćelijama koje luče GnRH. Podtip ETA receptora posredovao je u povećanju unutarćelijske sekrecije kalcija i GnRH. Endotelin-1 inhibira aktivni transport Na-K za čak 50% u bubrežnim tubulama i drugim tkivima (Zeidel et al., 1989). Okafor i Delamere (2001) primijetili su da prisutnost niskih razina ET1 u vodenoj masi u kombinaciji s potencijalom za oslobađanje ET1 iz cilijkih procesa ukazuje na to da bi kristalna leća mogla biti izložena ET1 in vivo. Proučavali su utjecaj ET1 na aktivni transport Na-K u svinjskoj leći. Njihovi rezultati sugeriraju da je ET1 inhibirao transport Na-K aktivnog sočiva, aktiviranjem EDNRA i EDNRB. Aktivacija ET receptora također je uzrokovala povećanje koncentracije citoplazmatskog kalcija u epitelnim čelijama kultivirane leće. Čini se da oba odgovora na ET1 imaju korak tirozin-kinaze.

Regija 5-prim je složeni CpG otok, koji dovodi do četiri pojedinačna transkripta koji započinju unutar otoka. Pao et al. (2001) analizirali su vezu između metilacije i ekspresije EDNRB -a u ljudskim tkivima. Otok CpG nije metiliran u normalnom tkivu prostate i mjehura, dok je metiliran u epitelu debelog crijeva; DNK iz tumora izvedenih iz ovih tkiva često je bila hipermetilirana. Analiza 11 pojedinačnih CpG lokacija na otoku CpG pokazala je da su specifična mjesta s visokim nivoom metilacije u nekoliko tumora i ćelijskih linija raka također metilirana u normalnim tkivima, što ukazuje na to da bi ta mjesta mogla poslužiti kao žarišta za daljnju de novo metilaciju. Nizak nivo metilacije u malom regionu unutar 5-prim regiona korelirao je sa ekspresijom transkripta sa najviše 5 prim-a, dok skoro potpuna metilacija 200 do 1000 bp nizvodno od početnog mjesta transkripcije nije blokirala ekspresiju ovog transkripta. Tretman sa 5-aza-2-prim-deoksicicitidinom izazvao je transkripcijsku aktivaciju sva četiri EDNRB transkripta. Autori su zaključili da postoji diferencijalna metilacija ovisna o tkivu na EDNRB 5-prim regiji, te da hipermetilacija odmah 3-prim na početno mjesto transkripcije ne sprječava inicijaciju. Oni su dalje predložili mehanizam širenja de novo metilacije, počevši od njenih određenih žarišta.

Endotelin-1 sintetiziraju keratinociti u normalnoj koži i lokalno se oslobađaju nakon ozljede kože. Može izazvati bol svojim djelovanjem na receptore endotelina-A lokalnih nociceptora, ali slučajno proizvodi analgeziju preko endotelin-B receptora. Khodorova et al. (2003) mapirali su endogeni analgetski krug, u kojem aktivacija endotelin-B receptora inducira oslobađanje beta-endorfina iz keratinocita i aktivaciju kalijevih kanala spojenih unutar G-veza povezanih s G-proteinom (GIRK, također zvanih Kir-3), povezanih s opioidnim receptorima na nociceptorima. Ovi rezultati ukazuju na postojanje intrinzičnog mehanizma povratne sprege za kontrolu periferne boli u koži, te su uspostavili keratinocite kao skupinu opioida kojima upravlja receptor endotelina-B.

Koristeći profiliranje ekspresije gena, Iwashita et al. (2003) utvrdili su da su geni povezani s Hirschsprungovom bolešću visoko regulirani u matičnim ćelijama nervnog grebena pacova, u odnosu na RNK cijelog fetusa. Geni sa najvećom ekspresijom bili su GDNF, SOX10, GFRA1 i EDNRB. Najveća ekspresija viđena je u RET-u , za koji je utvrđeno da je neophodan za migraciju matičnih ćelija nervnog grebena u crijevima. GDNF je promovirao migraciju matičnih ćelija nervog grebena u kulturi, ali nije uticao na njihovo preživljavanje ili proliferaciju. Njihova zapažanja potvrđena su kvantitativnom RT-PCR analizom, protočnom citometrijom i funkcionalnom analizom.

Wang et al. (2006) procijenili su ekspresiju EDNRB -a u glaukomskih optičkih živaca čovjeka i prostorni odnos između EDNRB -a i astrocita. Učestalost pozitivne imunoreaktivnosti EDNRB-a bila je značajno veća u glaukomskih optičkih živaca kod ljudi u usporedbi s kontrolom prema dobi (9/16 naspram 1/10). EDNRB je kolokaliziran astrocitnim procesima i kvantitativno je bio veći u glaukomatoznim očima. Zaključili su da povećana imunoreaktivnost EDNRB-a u oboljelim optičkim živcima, i njegova povezanost s astrocitima sugerira da bi glija-endotelinski sistem mogao biti uključen u patološke mehanizme neuronske degeneracije.

Koristeći transkripcijsko profiliranje mikrodiseciranih tumorskih endotelnih ćelija iz karcinoma jajnika kod ljudi, Buckanovich et al. (2008) otkrili su da je prekomjerna ekspresija ETBR povezana s odsustvom limfocita koji infiltriraju tumor i kratkim vremenom preživljavanja pacijenata. Inhibitor ETBR -a povećao je adheziju T-ćelija za endotel in vitro, a ovaj efekt je suzbijen blokadom ICAM1 ili tretmanom sa donorima dušik-oksida. Miševi liječeni inhibitorom ETBR pokazali su povećano preusmjeravanje T-ćelija ovisnih o Icam1 na tumore. Liječenje inhibitorom ETBR -a omogućilo je odgovor tumora u inače neefikasnoj imunoterapiji bez promjene sistemskog antitumorskog imunskog odgovora. Sugerirali su da bi mješovita blokada ETAR-ETBR mogla istodobno ciljati tumorske ćelije putem ETAR-a i pojačati antitumorske imunske mehanizme putem vaskularne ETBR.

Biohemijska svojstva[uredi | uredi izvor]

Kristalna struktura

Shihoya et al. (2016), izvijestili su o kristalnim strukturama ljudskog endotelinskog receptora tipa B, u obliku bez liganda i u kompleksu s endogenim agonistom endotelinom-1 . Analiza struktura i mutacija otkrila je mehanizam selektivnosti izopeptida između endotelina -1 i -3. Transmembranske spirale 1, 2, 6 i 7 pomiču se i omotavaju cijeli endotelinski peptid na gotovo nepovratan način. Konformacijske promjene inducirane agonistom, šire se na jezgro receptora i sučelje za spajanje citoplazmatskog G-proteina i vjerovatno induciraju konformacijsku fleksibilnost u TM6. Poređenje sa muskarinskim receptorom M2 (CHRM2) sugerisalo je zajednički mehanizam za prijenos signala u receptorima spojenim sa proteinom klase A.

Molekulska genetika[uredi | uredi izvor]

Sklonost Hirschsprungovoj bolesti 2

Puffenberger et al. (1994.) predstavili su dokaze da Hirschsprungova bolest (HSCR2), naizgled multigenski poremećaj, može u nekim slučajevima rezultirati mutacijom gena za receptor endotelina-B. EDNRB je bio kandidat-gen jer se mapirao u isto područje hromosoma 13 kao i HSCR2. Mutacija trp276-do-cys (W276C) bila je osjetljiva na dozu jer su homozigoti i heterozigoti imali 74%, odnosno 21% rizik od razvoja HSCR-a. Za sve kliničke oblike HSCR-a veća je učestalost megakolona kod muškaraca nego kod žena, a isto vrijedi i za specifičnu EDNRB mutaciju. Međutim, čini se da među menonitima najmanje pet megakolon-pacijenata nije nosilo mutaciju W276C EDNRB, prisutnu u većini pogođenih članova, što je sugeriralo postojanje još neotkrivenih gena osjetljivosti na HSCR.

Kusafuka et al. (1996) analizirali su sedam egzona za mutacije u genu EDNRB kod 41 izoliranog pacijenta sa HSCR-om. Otkrivene su dvije nove mutacije (131244.0003 i 131244.0004). Oba pacijenta sa novim mutacijama bili su heterozigoti. Nisu pružene informacije o porodicama ova dva slučaja, ali se pretpostavljalo da eksprimiraju nove mutacije. Amiel et al. (1996) prijavili su tri misens mutacije u genu EDNRB u heterozigotnom stanju u sporadičnim slučajevima HSCR -a. Chakravarti (1996) je tabelarno prikazao 12 mutacija u genu EDNRB identifikovanih u slučajevima Hirschsprungove bolesti do tada.[9]

Među 31 izoliranim slučajem Hirschsprungove bolesti u ne-inbred populaciji u Japanu, Tanaka et al. (1998) identificirali su tri nove mutacije u genu EDNRB: dvije transverzije, A do T i C do A kod nukleotida 311 (N104I), odnosno 1170 (S390R), te prijelaz T-do-C kod nukleotida 325 (C109R) . In vitro studije funkcionalne ekspresije na ćelijama jajnika kineskog hrčka otkrile su da receptori N104I pokazuju gotovo iste afinitete vezanja i funkcionalna svojstva kao divlji tip i mogu predstavljati polimorfizam. S druge strane, iako S390R nije promijenio afinitete vezanja, uzrokovao je smanjenje povećanja unutarćelijskog kalcija, induciranog ligandom i inhibiciju aktivnosti adenilil-ciklaze, pokazujući oštećenje unutarćelijske signalizacije. Pokazalo se da su receptori C109R lokalizirani u blizini jedara kao neobičan protein od 44 kD s izuzetno niskim afinitetom prema endotelinu-1 i da se ne mogu translocirati u plazmamembranu.

Chakravarti (1996) je procijenio da mutacije RET (164761) čine približno 50% slučajeva HSCR -a, a EDNRB mutacije približno 5%. HSCR kratkog segmenta javlja se u oko 25% slučajeva uzrokovanih RET-om i u više od 95% slučajeva povezanih s EDNRB. Dok homozigotnost za gen EDNRB može uzrokovati gluhoću i pigmentne anomalije, pored HSCR-a (npr. 131244.0002), homozigotni fenotip za RET nije primijećen.[10]

Carrasquillo et al. (2002) primijetili su da, iako je identificirano osam gena s mutacijama koje se mogu povezati s Hirschsprungovom bolešću, mutacije na pojedinim lokusima nisu potrebne niti dovoljne za izazivanje kliničke bolesti. Oni su proveli studiju udruživanja na čitavom genomu u 43 tripleta Menonitskih porodica (roditelji i pogođeno dijete) koristeći 2.083 mikrosatelita i jednonukleotidnih polimorfizama i novi metod neravnoteže povezivanja u više tačaka, koji je tražio povezanost porijeklom iz zajedničkog pretka. Identifikovali su lokus osjetljivosti na 10q11, 13q22 i 16q23 (HSCR8); pokazali su da je gen na 13q22 EDNRB, a gen na 10q11 je RET. Statistički značajan zajednički prijenos alela RET i EDNRB u pogođenih osoba i nekomplementacija aganglionoze u ukrštanju miševa između Ret-null i hipomorfnog alela Ednrb piebald, sugerirali su epistazu između EDNRB i RET. Nalazi sugeriraju da je genetička interakcija između mutacija u RET i EDNRB osnovni mehanizam ovog složenog poremećaja.

Sanchez-Mejias et al. (2010) pregledali su gene EDN3 i EDNRB kod 196 pacijenata sa Hirschsprungovom bolešću iz Španije, pomoću tečne hromatografije visokih performansi. Pronašli su 25 varijanti sekvence u genu EDNRB; 17 od njih bile su nove. Pregledali su dodatni egzon u smjeru 5-prim iz egzona 1 EDNRB-a, koji nikada ranije nije analiziran u kontekstu HSCR-a. Uključivanjem ovog dodatnog egzona dolaze do varijante transkripta, zvane EDNRB-delta-3, sa 89 dodatnih aminokiselina u N-terminalnoj regiji proteina, u odnosu na konvencijski EDNRB. Otkrili su tri varijante sekvence na 5' neprevedenom području ovog dodatnog egzona. Najupečatljiviji nalaz bilo je otkrivanje kodirajuće mutacije, lys15-do-ter (131244.0009), kod pacijentice s poradičnom Hirschsprungovom bolešću. Chakravarti (1996) procijenio je da mutacije RET čine približno 50% slučajeva HSCR-a, a EDNRB mutacije otprilike 5%. HSCR kratkog segmenta javlja se u oko 25% slučajeva uzrokovanih RET i u više od 95% slučajeva povezanih s EDNRB. Dok homozigotnost za gen EDNRB može uzrokovati gluhoću i pigmentne anomalije pored HSCR -a (npr. 131244.0002), homozigotni fenotip za RET nije primijećen.[11]

ABCD sindrom

Kod djeteta sa ABCD sindromom, o kojem su izvještavali Gross et al. (1995), Verheij et al. (2002) identifikovali su homozigotnu nonsens mutaciju u genu EDNRB (131244.0008). Zaključili su da ABCD sindrom nije zasebna cjelina, već oblik Shah-Waardenburgovog sindroma (WS4).

Životinjski model[uredi | uredi izvor]

Autosomno recesivna mutacija "uočljivo letalna" (sl) kod pacova okarakterizirana je odsustvom intramišlih ganglijskih ćelija u cijelom debelom crijevu i distalnom dijelu tankog crijeva, nalik na ljudsku Hirschsprungovu bolest. Ceccherini et al. (1995) isključili su vezu sl sa dva gena kandidata, RET protoonkogenom (RET) i endotelinom-3; međutim, visoko značajna ocjena loda (Z = 47,05 pri Ɵ = 0,0) pronađena je između EDNRB -a i fenotipa sl. Struktura egzona-introna pacovskog gena rekonstruirana je i svaki egzon sl pregledan je na mutacije. Pokazana je intersticijska delecija od 301 bp, koja obuhvata distalnu polovinu prvog kodirajućeg egzona (egzon 2) i proksimalni dio susjednog introna. Ova delecija rezultirala je sa dva transkripcijska proizvoda, 270 i 238 bp kraći od cDNK divljeg tipa. Gariepy et al, (1996) pokazali su da se delecija savršeno kosegregira sa fenotipom sl. Dovodi do proizvodnje aberantno prerađene EDNRB iRNK kojoj nedostaje kodirajuća sekvenca za prvi i drugi pretpostavljeni transmembranski domen receptora vezanog za G-protein. Testovi vezivanja radioliganda otkrili su neotkrivenu razinu funkcionalnog EDNRB-a u tkivima homozigotnih sl/sl pacova. Stoga su autori zaključili da EDNRB ima bitnu ulogu u normalnom razvoju dsvije ćelijske loze, izvedene iz nervog grebena, epidermnih melanocita i vrijevnih neurona, u tri vrste sisara: ljudi, miševa i pacova. Naveli su da se pacovi kojima nedostaje EDNRB mogu pokazati vrijednima u studijama o fiziologiji odraslih u zdravlju i bolestima, ako se sl pacov može spasiti od smrtonosnog fenotipa megakolona. Pokazali su da je tokom normalnog razvoja pacova obrazac ekspresije iRNK EDNRB konzistentan sa ekspresijom prekursorima crijevnog nervnog sistema (ENS) tokom kolonizacije crijeva. Koristili su promotorljudskih dopamin-beta-hidroksilaza (DBH), za usmjeravanje transgenske ekspresije EDNRB-a na kolonizaciju prekursora ENS-a u sl/sl pacova. Transgenaki DBH-EDNRB kompenzirao je nedostatni endogeni EDNRB kod ovih i spriječio razvoj kongenitalne intestinalne aganglionoze. Transgenoza nije uticala na ekspresiju boje dlake, što ukazuje na to da kritično vrijeme za ekspresiju EDNRB-a u razvoju ENS-a počinje nakon odvajanja loze melanocita od loze ENS-a i zajedničkog prekursora. Doziranje transgena uticalo je i na učestalost i na težinu urođenog crijevnog defekta, ukazujući na događaje ovisne o dozi nizvodno od aktivacije EDNRB-a u razvoju ENS-a.

Shin et al. (1997) pokušali su identificirati važne domene za funkciju EDNRB proučavajući četiri recesivna juvenilna smrtonosna alela u genu miša Ednrb stvorenom radijacijom ili hemijskim mutagenom. Molekulski nedostaci identificirani su u tri; u jednoj mutaciji, koja je povezana s normalnim nivoima Ednrb iRNK u mozgu odraslih, čini se da mutacija utiče na važne regulatorne elemente koji posreduju u ekspresiji gena tokom razvoja.

Sindrom letalnog bijelog ždrijebeta (LWFS) je kongenitalna anomalija konja slična Hirschsprungovoj bolesti, koju karakterizira bijela boja dlake i aganglionoza crijeva. Da bi istražili molekulsku osnovu LWFS -a, Yang et al. (1998) pokazali su da cDNK pune dužine za EDNRB konja sadrži otvoreni okvir čitanja od 1,329 bp koji je kodirao 443 aminokiselinska ostatka.[12] Predviđena aminokiselinska sekvenca bila je 89%, 91% i 85% identična s EDNRB sekvencama ljudi, goveda i miša/pacova, ali samo 55% identična s EDNRA sekvencama ljudi, goveda i pacova. Kada je homozigotna, kao osnova LWFS-a pronađena je dinukleotidna mutacija, TC-u-AG, koja je promijenila izoleucin u lizin u predviđenom prvom transmembranskom domenu proteina EDNRB; heterozigotno stanje rezultiralo je fenomenom 'overro'. Mutacija dinukleotida uključivala je nukleotide 353 i 354. Ranije je bilo poznato da se LWFS najčešće proizvodi parenjem konja sa šarom overo boje. Jedan mutirani alel proizvodi promjenu boje dlake, ali čini se da prisutnost najmanje jednog normalnog alela štiti od razvoja aganglionoze.

Metallinos et al. (1998) također su pokazali da je misens mutacija ile118-do-lys u EDNRB odgovorna za sindrom smrtonosnog bijelog ždrijebca. Uzgoj između određenih pjegavih konja, općenito opisan kao okvir overo, proizvodi neku ždrebad koja su, za razliku od njihovih roditelja, sva bijela ili gotovo sva bijela i uginu ubrzo nakon rođenja, zbog teške blokade crijeva. Ova ždrebad imaju aganglionozu koju karakterizira nedostatak submukoznih i mijeternih ganglija od distalnog dijela tankog do debelog crijeva, slično ljudskoj Hirschsprungovoj bolesti. Otkrili su da se sindrom smrtonosnog bijelog ždrijebeta javio u homozigota; heterozigoti su pokazali okvirni overro obrazac. Konji sa oznakama tobiano uključivali su neke nositelje gena, što ukazuje na to da je tobiano epistazan u odnosu na okvir. Osim toga, neki konji identificirani kao nositelji nisu imali prepoznat fenotipski obrazac ogrtača, što pokazuje nepotpunu penetraciju mutacije. Santschi et al. (1998) su također proučavali promjenu ile118-do-lys u sindromu overo smrtonosne bijele kod ždrebadi rođenih od roditelja American Paint Horse iz loze sa uzorkom overo kaputa.

Kako bi utvrdili kada je EDNRB signalizacija potrebna tokom embriogeneze, iskoristili su sistem induciran tetraciklinom za stvaranje sojeva miševa koji su eksprimirali Ednrb u različitim fazama embriogeneze. Shin et al. (1999) utvrdili su da je Ednrb potreban u ograničenom periodu razvoja nervnog grebena između embrionskih dana 10 i 12,5. Zaključili su da je EDNRB potreban za migraciju i melanoblasta i crijevnih neuroblasta. Uloga receptora endotelina-B u vaskularnoj homeostazi je kontroverzna, jer receptor ima i supresivne i depresivne efekte in vivo. Uočena letalnost kod pacova nosi prirodno prisutnu deleciju gena za receptor endotelina-B, koji potpuno poništava funkcionalnu ekspresiju receptora. Homozigotni pacovi za ovu mutaciju umiru ubrzo nakon rođenja zbog urođene distalne crijevne aganglionoze. Genetičko spašavanje homozigotnih štakora od ove razvojne greške upotrebom transgenske dopaminske hidroksilaze-EDNRB rezultiralo je odraslim štakorima s nedostatkom ETB-a (Gariepy et al. (2000). Na ishrani s nedostatkom natrija, pacovi su imali normalan arterijski krvni pritisak, ali na ishrani s visokim udjelom natrija, homozigotni pacovi su postali ozbiljno hipertenzivni. Normalni pritisak vraćen je hranjenjem solju, kada je epitelni natrijev kanal blokiran amiloridom. Gariepy et al. (2000) zaključili su da su spašeni sl/sl pacovi novi genetički model s jednim lokusom teške hipertenzije osjetljive na soli. Rezultati sugeriraju da su ovi pacovi hipertenzivni jer nemaju normalnu tonusnu inhibiciju bubrežnog epitelnog natrijevog kanala.

Matsushima et al. (2002) opisali su novog mutiranog miša s mutacijom u genu Ednrb i predložili ga kao životinjski model Waardenburgovog sindroma 4 (WS4) ili Waardenburg-Shahovog sindroma, koji kombinira Hirschsprungovu bolest sa obilježjima Waardenburgovog sindroma. Ovi mutanti imali su mješovitu genetičku pozadinu i opsežnu bijelu pjegavost. Uginuli su između 2. i 7. sedmice nakon rođenja uslijed megakolona; njihovom debelom crijevu distalno od megakolona nedostajale su Auerbachove ćelije pleksusa. Ovi mutanti nisu reagirali na zvuk, a stria vascularis njihovih pužnica nije imala posredne ćelije, tj. melanocite izvedene iz živčanog grebena. Nasljeđivanje je bilo autosomno recesivno, kao i kod ljudi s WS4. Analiza uzgoja otkrila je da su WS4 miševi alelni sa piebald-smrtonosnim i JF1 miševima, koji su također mutirani u genu Ednrb. Analiza mutacija pokazala je da genu Ednrb nedostaje 318 nukleotida koji kodiraju transmembranske domene, zbog delecije egzona 2 i 3. Interakcija između endotelina-3 i njegovog receptora potrebna je za normalnu diferencijaciju i razvoj melanocita i stanica Auerbachovog pleksusa.

Carpenter et al. (2003) proučavali su stvaranje plućnog edema kod pacova s nedostatkom EDNRB. U normoksiji, pacovi EDNRB –/– imali su značajno više propuštanja krvnih sudova u plućima od heterozigota ili kontrola. Hipoksija je povećala vaskularno curenje, bez obzira na genotip, a hipoksični pacovi s nedostatkom EDNRB procurili su više od hipoksičnih kontrola. Štakori s nedostatkom EDNRB-a imali su veći nivo endotelina u plućima i u normoksiji i u hipoksiji. Faktori-1-alfa-inducirani plućnom hipoksijom (HIF1A) i vaskularni endotelni faktor rasta (VEGF) bili su veći kod pacova s nedostatkom EDNRB-a i u normoksiji i u hipoksiji, a oba su nivoa smanjena antagonizmom EDNRA. Blokada EDNRA i antagonizam VEGF smanjili su vaskularno curenje u hipoksičnih pacova s nedostatkom EDNRB. Zaključili su da pacovi s nedostatkom EDNRB-a pokazuju prenaglašeno curenje cirkulacijskog plućnog proteina u normoksiji, da hipoksija pogoršava to curenje, te da se taj učinak djelimično može pripisati povećanju sadržaja VEGF-a u plućima, posredovanom endotelinom.

Migracija prekursora crijevnog nervnog sistema (ENS) u debelo crijevo zahtijeva ekspresiju EDNRB gena u određeno vrijeme. U studijama na miševima, Zhu et al. (2004) pronašli su konzervirani prostornovremenski ENS pojačivač Ednrba. Ovaj pojačivač od 1 kb aktiviran je kako su se prekursori ENS-a približavali debelom crijevu, a djelimična delecija pojačivača na endogenom lokusu Ednrb rezultirala je pigmentiranim miševima, koji su postnatalno uginuli od megakolona. U Ennrb ENS pojačivaču, identificirali su mjesta vezivanja za Sox10, transkripcijski faktor povezan sa SRY povezan s Hirschsprungovom bolešću, a mutacijske analize ovih lokusa sugerirale su da SOX10 može imati više uloga u regulaciji EDNRB-a u ENS-u. Cantrell et al. (2004) testirali su povezanost gena u signalnom putu endotelina i ozbiljnost aganglionoze u proširenom rodoslovu miševa B6C3FeLe.Sox10 (Dom). Analiza asocijacije jednog lokusa identifikovala je interakciju između EdnrB i Sox10. Dodatna analiza F2potomstva ukrštanja potvrdila je visoko značajan učinak alela EdnrB na fenotip Sox10 (Dom/+). Prisutnost alela C57BL/6J u EdnrB bila je povezana s povećanom penetracijom i težom aganglionozom u Sox10 (Dom) mutanata. Ukrštanje između mutanata EdnrB i Sox10 potvrdilo je ovu interakciju gena, pri čemu je dvostruko mutirano potomstvo pokazalo znatno ozbiljniju aganglionozu. Pozadina mutantmog soja EdnrB dodatno je uticala na fenotip Sox10/EdnrB dvostruko mutiranog potomstva, implicirajući djelovanje dodatnih modifikatora na ovaj fenotip.

Kod odraslih transgenih miševa sa uslovljenom srčano ograničenom ET1 prekomjernom ekspresijom, Yang et al. (2004) uočili su translokaciju jedarnog faktora kappa-B, ekspresiju citokina, upalu i hipertrofiju, što je rezultiralo dilatiranom kardiomiopatijom, kongestivnom srčanom insuficijencijom i smrću već 5. sedmice nakon indukcije transgena. Uočeno je značajno produženje preživljavanja kod kombiniranog antagoniste EDNRA/EDNRB, ali ne i kod antagonista selektivnih prema EDNRA, što je u skladu s važnom ulogom EDNRB-a u ovom modelu.[13]

Regulacija[uredi | uredi izvor]

U melanocitima, EDNRB gen je reguliran transkripcijskim faktorom povezanim s mikroftalmijom. Mutacije oba gena su veze sa Waardenburgov sindrom. [14][15]

Klinički značaj[uredi | uredi izvor]

Multigeni poremećaj, Hirschsprungova bolest tip 2, posljedica je mutacije u genu receptora endotelinskog tipa B.[16]

Interakcije[uredi | uredi izvor]

Pokazano je da endotelinski receptor tipa B stupa u interakciju sa kaveolinom 1.[17]

Ligandi[uredi | uredi izvor]

Agonisti
Antagonisti
  • A-192,621
  • BQ-788
  • Bosentan (neselectivni ETA / ETB antagonist)

Također pogledajte[uredi | uredi izvor]

References[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000136160 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000022122 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Cyr C, Huebner K, Druck T, Kris R (Nov 1991). "Cloning and chromosomal localization of a human endothelin ETA receptor". Biochemical and Biophysical Research Communications. 181 (1): 184–90. doi:10.1016/S0006-291X(05)81399-3. PMID 1659806.
  6. ^ Arai, H., Nakao, K., Takaya, K., Hosoda, K., Ogawa, Y., Nakanishi, S., Imura, H. The human endothelin-B receptor gene: structural organization and chromosomal assignment. J. Biol. Chem. 268: 3463-3470, 1993. PubMed: 8429023
  7. ^ "UniProt, P24530". Pristupljeno 2017-09-11. CS1 održavanje: nepreporučeni parametar (link)
  8. ^ "Entrez Gene: EDNRB endothelin receptor type B".
  9. ^ Amiel, J., Attie, T., Jan, D., Pelet, A., Edery, P., Bidaud, C., Lacombe, D., Tam, P., Simeoni, J., Flori, E., Nihoul-Fekete, C., Munnich, A., Lyonnet, S. Heterozygous endothelin receptor B (EDNRB) mutations in isolated Hirschsprung disease. Hum. Molec. Genet. 5: 355-357, 1996. PubMed: 8852660
  10. ^ Chakravarti, A. Endothelin receptor-mediated signaling in Hirschsprung disease. Hum. Molec. Genet. 5: 303-307, 1996. PubMed: 8852653
  11. ^ Carrasquillo, M. M., McCallion, A. S., Puffenberger, E. G., Kashuk, C. S., Nouri, N., Chakravarti, A. Genome-wide association study and mouse model identify interaction between RET and EDNRB pathways in Hirschsprung disease. Nature Genet. 32: 237-244, 2002. PubMed: 12355085
  12. ^ Yang, G. C., Croaker, D., Zhang, A. L., Manglick, P., Cartmill, T., Cass, D. A dinucleotide mutation in the endothelin-B receptor gene is associated with lethal white foal syndrome (LWFS); a horse variant of Hirschsprung disease (HSCR). Hum. Molec. Genet. 7: 1047-1052, 1998. PubMed: 9580670y
  13. ^ Yang, L. L., Gros, R., Kabir, M. G., Sadi, A., Gotlieb, A. I., Husain, M., Stewart, D. J. Conditional cardiac overexpression of endothelin-1 induces inflammation and dilated cardiomyopathy in mice. Circulation 109: 255-261, 2004. PubMed: 14718401
  14. ^ Sato-Jin K, Nishimura EK, Akasaka E, Huber W, Nakano H, Miller A, Du J, Wu M, Hanada K, Sawamura D, Fisher DE, Imokawa G (Apr 2008). "Epistatic connections between microphthalmia-associated transcription factor and endothelin signaling in Waardenburg syndrome and other pigmentary disorders". FASEB Journal. 22 (4): 1155–68. doi:10.1096/fj.07-9080com. PMID 18039926.
  15. ^ Hoek KS, Schlegel NC, Eichhoff OM, Widmer DS, Praetorius C, Einarsson SO, Valgeirsdottir S, Bergsteinsdottir K, Schepsky A, Dummer R, Steingrimsson E (Dec 2008). "Novel MITF targets identified using a two-step DNA microarray strategy". Pigment Cell & Melanoma Research. 21 (6): 665–76. doi:10.1111/j.1755-148X.2008.00505.x. PMID 19067971.
  16. ^ Tanaka H, Moroi K, Iwai J, Takahashi H, Ohnuma N, Hori S, Takimoto M, Nishiyama M, Masaki T, Yanagisawa M, Sekiya S, Kimura S (May 1998). "Novel mutations of the endothelin B receptor gene in patients with Hirschsprung's disease and their characterization". The Journal of Biological Chemistry. 273 (18): 11378–83. doi:10.1074/jbc.273.18.11378. PMID 9556633.
  17. ^ Yamaguchi T, Murata Y, Fujiyoshi Y, Doi T (Apr 2003). "Regulated interaction of endothelin B receptor with caveolin-1". European Journal of Biochemistry / FEBS. 270 (8): 1816–27. doi:10.1046/j.1432-1033.2003.03544.x. PMID 12694195.
  18. ^ Maguire JJ, Davenport AP (Dec 2014). "Endothelin@25 - new agonists, antagonists, inhibitors and emerging research frontiers: IUPHAR Review 12". British Journal of Pharmacology. 171 (24): 5555–72. doi:10.1111/bph.12874. PMC 4290702. PMID 25131455.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]

Šablon:G protein-spregnuti receptori Šablon:Peptidergici