EGF

S Wikipedije, slobodne enciklopedije
EGF
1a3p egf.png
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1IVO, 1JL9, 1NQL, 1P9J, 2KV4, 3NJP

Identifikatori
AliasiEGF
Vanjski ID-jeviOMIM: 131530 MGI: 95290 HomoloGene: 1483 GeneCards: EGF
Lokacija gena (čovjek)
Hromosom 4 (čovjek)
Hrom.Hromosom 4 (čovjek)[1]
Hromosom 4 (čovjek)
Genomska lokacija za EGF
Genomska lokacija za EGF
Bend4q25Početak109,912,883 bp[1]
Kraj110,013,766 bp[1]
Lokacija gena (miš)
Hromosom 3 (miš)
Hrom.Hromosom 3 (miš)[2]
Hromosom 3 (miš)
Genomska lokacija za EGF
Genomska lokacija za EGF
Bend3 G3|3 58.5 cMPočetak129,471,214 bp[2]
Kraj129,548,965 bp[2]
Obrazac RNK ekspresije
PBB GE EGF 206254 at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija calcium ion binding
transmembrane receptor protein tyrosine kinase activator activity
epidermal growth factor receptor binding
Wnt-protein binding
GO:0001948, GO:0016582 protein binding
growth factor activity
Wnt-activated receptor activity
protein tyrosine kinase activity
phosphatidylinositol-4,5-bisphosphate 3-kinase activity
Ćelijska komponenta integral component of membrane
membrana
receptor complex
extracellular region
lysosomal membrane
Egzosom
platelet alpha granule lumen
Vanćelijsko
clathrin-coated vesicle membrane
Ćelijska membrana
Biološki proces negative regulation of epidermal growth factor receptor signaling pathway
positive regulation of MAP kinase activity
epidermal growth factor receptor signaling pathway
regulation of protein localization to cell surface
ERK1 and ERK2 cascade
platelet degranulation
regulation of calcium ion import
mammary gland alveolus development
MAPK cascade
Replikacija DNK
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
negative regulation of secretion
positive regulation of hyaluronan biosynthetic process
positive regulation of peptidyl-threonine phosphorylation
positive regulation of ubiquitin-dependent protein catabolic process
Angiogeneza
Wnt signaling pathway involved in dorsal/ventral axis specification
positive regulation of cell population proliferation
positive regulation of peptidyl-tyrosine phosphorylation
positive regulation of cerebellar granule cell precursor proliferation
canonical Wnt signaling pathway
negative regulation of cholesterol efflux
peptidyl-tyrosine phosphorylation
positive regulation of DNA binding
positive regulation of phosphorylation
positive regulation of mitotic nuclear division
branching morphogenesis of an epithelial tube
GO:0072468 signal transduction
regulation of peptidyl-tyrosine phosphorylation
ERBB2 signaling pathway
phosphatidylinositol phosphate biosynthetic process
positive regulation of protein tyrosine kinase activity
activation of transmembrane receptor protein tyrosine kinase activity
regulation of cell motility
positive regulation of receptor internalization
positive regulation of epidermal growth factor-activated receptor activity
membrane organization
negative regulation of ERBB signaling pathway
embryonic retina morphogenesis in camera-type eye
GO:1901313 positive regulation of gene expression
positive regulation of cell migration
positive regulation of protein kinase B signaling
negative regulation of Notch signaling pathway
regulation of receptor signaling pathway via JAK-STAT
positive regulation of canonical Wnt signaling pathway
positive regulation of protein localization to early endosome
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001178130
NM_001178131
NM_001963
NM_001357021

NM_010113
NM_001310737
NM_001329594

RefSeq (bjelančevina)

NP_001171601
NP_001171602
NP_001954
NP_001343950

NP_001297666
NP_001316523
NP_034243

Lokacija (UCSC)Chr 4: 109.91 – 110.01 MbChr 3: 129.47 – 129.55 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Epidermni faktor rasta (EGF) jest protein koji je kod ljudi kodiran genom sa hromosoma 4. Stimulira ćelijski rast i diferencijaciju vezivanjem za svoj receptor, EGFR[5] i ima 53 aminokiselinska ostatka i tri unutarmolekulske disulfidne veze.[6]

EGF je prvobitno opisan kao izlučeni peptid koji se nalazi u submaksilskim žlijezdama miševa i u ljudskom urinu. EGF je od tada pronađen u mnogim ljudskim tkivima, uključujući submandibulsku žlijezdu (submaksillska žlijezda),[7] i paratidnim žlijezdama.[7] U početku, ljudski EGF bio poznat kao urogastron.[8]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 1.207 aminokiselina, а molekulska težina 133.994 Da.[9]

1020304050
MLLTLIILLPVVSKFSFVSLSAPQHWSCPEGTLAGNGNSTCVGPAPFLIF
SHGNSIFRIDTEGTNYEQLVVDAGVSVIMDFHYNEKRIYWVDLERQLLQR
VFLNGSRQERVCNIEKNVSGMAINWINEEVIWSNQQEGIITVTDMKGNNS
HILLSALKYPANVAVDPVERFIFWSSEVAGSLYRADLDGVGVKALLETSE
KITAVSLDVLDKRLFWIQYNREGSNSLICSCDYDGGSVHISKHPTQHNLF
AMSLFGDRIFYSTWKMKTIWIANKHTGKDMVRINLHSSFVPLGELKVVHP
LAQPKAEDDTWEPEQKLCKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRD
RKYCEDVNECAFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVS
CPRNVSECSHDCVLTSEGPLCFCPEGSVLERDGKTCSGCSSPDNGGCSQL
CVPLSPVSWECDCFPGYDLQLDEKSCAASGPQPFLLFANSQDIRHMHFDG
TDYGTLLSQQMGMVYALDHDPVENKIYFAHTALKWIERANMDGSQRERLI
EEGVDVPEGLAVDWIGRRFYWTDRGKSLIGRSDLNGKRSKIITKENISQP
RGIAVHPMAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITID
FLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFS
DWAMPSVMRVNKRTGKDRVRLQGSMLKPSSLVVVHPLAKPGADPCLYQNG
GCEHICKKRLGTAWCSCREGFMKASDGKTCLALDGHQLLAGGEVDLKNQV
TPLDILSKTRVSEDNITESQHMLVAEIMVSDQDDCAPVGCSMYARCISEG
EDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCRCS
EGYQGDGIHCLDIDECQLGEHSCGENASCTNTEGGYTCMCAGRLSEPGLI
CPDSTPPPHLREDDHHYSVRNSDSECPLSHDGYCLHDGVCMYIEALDKYA
CNCVVGYIGERCQYRDLKWWELRHAGHGQQQKVIVVAVCVVVLVMLLLLS
LWGAHYYRTQKLLSKNPKNPYEESSRDVRSRRPADTEDGMSSCPQPWFVV
IKEHQDLKNGGQPVAGEDGQAADGSMQPTSWRQEPQLCGMGTEQGCWIPV
SSDKGSCPQVMERSFHMPSYGTQTLEGGVEKPHSLLSANPLWQQRALDPP
HQMELTQ

Struktura[uredi | uredi izvor]

Kod ljudi, EGF ima 53 aminokiseline (sekvenca NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR),[6] i molekulsku masu od oko 6 kDa.[5] Sadrži tri disulfidna mosta (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).[6]

Funkcija[uredi | uredi izvor]

EGF, putem vezivanja za njegovih srodnih receptora, rezultira ćelijskom proliferacijom, diferencijacijom i preživljavanjem.[10]

EGF pljuvačke, za koji se čini da se regulira neorganski jod u ishrani, također ima važnu fiziološku ulogu u održavanju integriteta oro-ezofagnog i želudačnog tkiva. Biološki efekti EGF-a pljuvačke uključuju zacjeljivanje usnih i gastrojednjačkih ulkusa, inhibiciju lučenja želučane kiseline, stimulaciju sinteze DNK, kao i zaštitu sluznica od unutarlumenskih štetnih faktora kao što su želučana kiselina, žučne kiseline, pepsin i tripsin te fizičkih, kemijskih i bakterijskih agenasa.[7]

Biološki izvori[uredi | uredi izvor]

Faktor epidermnog rasta može se naći u urinu, pljuvački, mlijeku, suzama i krvnoj plazmi.[11] Može se naći poddonjevuličnoj žlijezdi,[7][12] i parotidnoj žlijezdi.[7][12] Utvrđeno je da je proizvodnja EGF-a stimulirana testosteronomom.

Polipeptidni faktori rasta[uredi | uredi izvor]

Polipeptidni faktori rasta uključuju:[13]

Broj sekretora Faktor rasta Izvor Glavna funkcija
1 Epidermnifaktor tasta (EGF) Pjuvačne žlijezde Stimulira rast epidermnih i epitelnih ćelija
2 Trombocitni faktor rasta Trombociti Stimulira rast mezenhimskih ćelija, pospešuje zarastanje rana
3 Transformirajući faktor rasta alfa Epitelne ćelije Sličan EGF-u
4 Transformirajući faktor rasta beta Trombociti, bubrezi, placenta Inhibitorni efekt na kulture tumorskih ćelija
5 Eritropoetin Bubrezi Stimulira razvoj eritropoetskih ćelija
6 Nervni faktor rasta (NGF) Pljuvačne žlijezde Stimulira rast senzornih nerava
7 Insulinoliki faktor rasta growth Serum Stimulira ugradnju sulfata u hrskavicu, na određene ćelije djeluje slično insulinu
8 Faktor tumorske nekroze Monociti Nekroza tumorskih ćelija
9 Interleukin-1 Monociti, Leukociti Stimulira sintezu interleukina IL-2
10 Interleukin-2 Limfociti Stimulira rast i sazrijevanje T-ćelija

Mehanizam[uredi | uredi izvor]

Dijagram sa ključnim komponentama MAPK/ERK puta. "P" predstavlja fosfat. Obratiti pažnju na EGF na samom vrhu.

EGF djeluje tako što se vezuje sa visokim afinitetom za receptor epidermnog faktora rasta (EGFR) na površini ćelije. Ovo stimulira dimerizaciju izazvanu ligandom,[14] pokrećući unutrašnje aktivnosti receptora protein-tirozin kinaze (vidi drugi dijagram). Aktivnost tirozin-kinaza, zauzvrat, pokreće transdukciju signala, kaskadu koja rezultira raznim biohemijskim promjenama unutar ćelije – porastom unutarćelijskih nivoa kalcija, glikolize, sinteze proteina i povećanjem ekspresije određenih gena, uključujući gen za EGFR – što na kraju dovodi do sinteze DNK i proliferacije ćelija.[15]

EGF-porodica/EGF-liki domen[uredi | uredi izvor]

EGF je osnivač EGF-porodice proteina. Članovi ove porodice proteina imaju vrlo slične strukturne i funkcionalne karakteristike. Osim samog EGF-a, tu su i drugi članovi porodice:[16]

Svi članovi porodice sadrže po jedno ili više ponavljanja konzervirane aminokiselinske sekvence: CX7CX4-5CX10-13CXCX8GXRC

Ccistein, Gglicin, Rarginin i X – bilo koja aminokiselina.[16]

Ova sekvenca sadrži šest cisteinskih ostataka koji formiraju tri intramolekulske disulfidne veze. Formiranje disulfidne veze stvara tri strukturne petlje koje su neophodne za vezivanje visokog afiniteta između članova porodice EGF i njihovih površinskih receptora.[5]

Interakcije[uredi | uredi izvor]

Pokazalo se da epidermni faktor rasta ima interakcije sa svojim receptorom.[17][18]

Medicinska upotreba[uredi | uredi izvor]

Rekombinantni ljudski epidermni faktor rasta, koji se prodaje pod robnom markom Heberprot-P, koristi se za liječenje čireva na dijabetičkom stopalu. Može se dati injekcijom u mjesto rane,[19] ili se može koristiti lokalno.[20] Probni dokazi pokazuju poboljšano zacjeljivanje rana.[21] Sigurnost je slabo proučena.[21]

EGF se koristi za modifikaciju sintetskih skela za proizvodnju bioinženjerstvenih transplantata emulzijskomom elektroporaciom ili metodima modifikacije površine.[22][23]

Regeneracija kostiju[uredi | uredi izvor]

EGF ima pojačanu ulogu u osteogenoj diferencijaciji matičnim ćelijama zubne pulpe (DPSC) jer je sposoban povećati mineralizaciju vanćelijskog matriksa. Niska koncentracija EGF-a (10 ng/ml) dovoljna je da izazove morfološke i druge fenotipske promjene. Ovi podaci sugeriraju da bi DPSC u kombinaciji sa EGF-om mogli biti efikasna terapija zasnovana na matičnim ćelijama za koštano tkivo i inženjerskoj primjeni u parodentologiji i oralnoj implantologiji.[24]

Historija[uredi | uredi izvor]

EGF je bio drugi faktor rasta koji je identificiran.[25] Initially, human EGF was known as urogastrone.[8] Stanly Cohen je otkrio EGF dok je radio sa Ritom Levi-Montalcini na Washington University in St. Louis, tokom eksperimenata istraživanja nervnog faktora rastafaktora rasta (NGF). Za ova otkrića Levi-Montalcini i Cohen su 1986. dobili Nobelovu nagradu za fiziologiju ili medicinu.

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000138798 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000028017 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b c Harris RC, Chung E, Coffey RJ (mart 2003). "EGF receptor ligands". Experimental Cell Research. 284 (1): 2–13. doi:10.1016/S0014-4827(02)00105-2. PMID 12648462.
  6. ^ a b c Carpenter G, Cohen S (maj 1990). "Epidermal growth factor". The Journal of Biological Chemistry. 265 (14): 7709–12. doi:10.1016/S0021-9258(19)38983-5. PMID 2186024. Arhivirano s originala, 5. 11. 2008. Pristupljeno 28. 10. 2021.
  7. ^ a b c d e Venturi S, Venturi M (2009). "Iodine in evolution of salivary glands and in oral health". Nutrition and Health. 20 (2): 119–34. doi:10.1177/026010600902000204. PMID 19835108. S2CID 25710052.
  8. ^ a b Hollenberg MD, Gregory H (maj 1980). "Epidermal growth factor-urogastrone: biological activity and receptor binding of derivatives". Molecular Pharmacology. 17 (3): 314–20. PMID 6248761.
  9. ^ "UniProt, P01133" (jezik: engleski). Pristupljeno 28. 10. 2021.
  10. ^ Herbst RS (2004). "Review of epidermal growth factor receptor biology". International Journal of Radiation Oncology, Biology, Physics. 59 (2 Suppl): 21–6. doi:10.1016/j.ijrobp.2003.11.041. PMID 15142631.
  11. ^ Kumar V, Abbas AK, Fausto N, Robbins SL, Cotran RS (2005). Robbins and Cotran pathologic basis of disease (7th izd.). St. Louis, Mo: Elsevier Saunders. ISBN 978-0-7216-0187-8.
  12. ^ a b Chao J (1. 1. 2013), Rawlings ND, Salvesen G (ured.), "Chapter 624 - Mouse Kallikrein 9, Epidermal Growth Factor-binding Protein", Handbook of Proteolytic Enzymes (Third izd.), Academic Press, str. 2830–2831, doi:10.1016/b978-0-12-382219-2.00624-4, ISBN 978-0-12-382219-2
  13. ^ Satyanarayana U (2002). Biochemistry (2nd izd.). Kolkata, India: Books and Allied. ISBN 8187134801. OCLC 71209231.
  14. ^ Dawson JP, Berger MB, Lin CC, Schlessinger J, Lemmon MA, Ferguson KM (septembar 2005). "Epidermal growth factor receptor dimerization and activation require ligand-induced conformational changes in the dimer interface". Molecular and Cellular Biology. 25 (17): 7734–42. doi:10.1128/MCB.25.17.7734-7742.2005. PMC 1190273. PMID 16107719.
  15. ^ Fallon JH, Seroogy KB, Loughlin SE, Morrison RS, Bradshaw RA, Knaver DJ, Cunningham DD (juni 1984). "Epidermal growth factor immunoreactive material in the central nervous system: location and development". Science. 224 (4653): 1107–9. doi:10.1126/science.6144184. PMID 6144184.
  16. ^ a b Dreux AC, Lamb DJ, Modjtahedi H, Ferns GA (maj 2006). "The epidermal growth factor receptors and their family of ligands: their putative role in atherogenesis". Atherosclerosis. 186 (1): 38–53. doi:10.1016/j.atherosclerosis.2005.06.038. PMID 16076471.
  17. ^ Stortelers C, Souriau C, van Liempt E, van de Poll ML, van Zoelen EJ (juli 2002). "Role of the N-terminus of epidermal growth factor in ErbB-2/ErbB-3 binding studied by phage display". Biochemistry. 41 (27): 8732–41. doi:10.1021/bi025878c. PMID 12093292.
  18. ^ Wong L, Deb TB, Thompson SA, Wells A, Johnson GR (mart 1999). "A differential requirement for the COOH-terminal region of the epidermal growth factor (EGF) receptor in amphiregulin and EGF mitogenic signaling". The Journal of Biological Chemistry. 274 (13): 8900–9. doi:10.1074/jbc.274.13.8900. PMID 10085134.
  19. ^ Berlanga J, Fernández JI, López E, López PA, del Río A, Valenzuela C, Baldomero J, Muzio V, Raíces M, Silva R, Acevedo BE, Herrera L (januar 2013). "Heberprot-P: a novel product for treating advanced diabetic foot ulcer". MEDICC Review. 15 (1): 11–5. doi:10.1590/s1555-79602013000100004. PMID 23396236.
  20. ^ Yang S, Geng Z, Ma K, Sun X, Fu X (juni 2016). "Efficacy of Topical Recombinant Human Epidermal Growth Factor for Treatment of Diabetic Foot Ulcer: A Systematic Review and Meta-Analysis". The International Journal of Lower Extremity Wounds. 15 (2): 120–5. doi:10.1177/1534734616645444. PMID 27151755. S2CID 43897291.
  21. ^ a b Martí-Carvajal AJ, Gluud C, Nicola S, Simancas-Racines D, Reveiz L, Oliva P, Cedeño-Taborda J (oktobar 2015). "Growth factors for treating diabetic foot ulcers". The Cochrane Database of Systematic Reviews. 10 (10): CD008548. doi:10.1002/14651858.CD008548.pub2. PMID 26509249.
  22. ^ Haddad T, Noel S, Liberelle B, El Ayoubi R, Ajji A, De Crescenzo G (januar 2016). "Fabrication and surface modification of poly lactic acid (PLA) scaffolds with epidermal growth factor for neural tissue engineering". Biomatter. 6 (1): e1231276. doi:10.1080/21592535.2016.1231276. PMC 5098722. PMID 27740881.
  23. ^ Tenchurin T, Lyundup A, Demchenko A, Krasheninnikov M, Balyasin M, Klabukov I, Shepelev AD, Mamagulashvili VG, Orehov AS (2017). "Modification of biodegradable fibrous scaffolds with Epidermal Growth Factor by emulsion electrospinning for promotion of epithelial cells proliferation". Гены и клетки (jezik: ruski). 12 (4): 47–52. doi:10.23868/201707029.
  24. ^ Del Angel-Mosqueda C, Gutiérrez-Puente Y, López-Lozano AP, Romero-Zavaleta RE, Mendiola-Jiménez A, Medina-De la Garza CE, Márquez-M M, De la Garza-Ramos MA (septembar 2015). "Epidermal growth factor enhances osteogenic differentiation of dental pulp stem cells in vitro". Head & Face Medicine. 11: 29. doi:10.1186/s13005-015-0086-5. PMC 4558932. PMID 26334535.
  25. ^ JC (1. 1. 2006). "Epidermal growth factors". u Laurent GJ, Shapiro SD (ured.). Encyclopedia of Respiratory Medicine (jezik: engleski). Oxford: Academic Press. str. 129–133. doi:10.1016/b0-12-370879-6/00138-1. ISBN 978-0-12-370879-3. Pristupljeno 30. 11. 2020. Parametar |title= nedostaje ili je prazan (pomoć)

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]

Šablon:Gastrointestinalni hormoni