ERICH5

S Wikipedije, slobodne enciklopedije
ERICH5
Identifikatori
AliasiERICH5
Vanjski ID-jeviMGI: 2447772 HomoloGene: 52129 GeneCards: ERICH5
Lokacija gena (čovjek)
Hromosom 8 (čovjek)
Hrom.Hromosom 8 (čovjek)[1]
Hromosom 8 (čovjek)
Genomska lokacija za ERICH5
Genomska lokacija za ERICH5
Bend8q22.2Početak98,064,522 bp[1]
Kraj98,093,610 bp[1]
Lokacija gena (miš)
Hromosom 15 (miš)
Hrom.Hromosom 15 (miš)[2]
Hromosom 15 (miš)
Genomska lokacija za ERICH5
Genomska lokacija za ERICH5
Bend15|15 B3.1Početak34,453,451 bp[2]
Kraj34,474,038 bp[2]
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_173549
NM_001170806

NM_173421

RefSeq (bjelančevina)

NP_001164277
NP_775820

NP_775597

Lokacija (UCSC)Chr 8: 98.06 – 98.09 MbChr 15: 34.45 – 34.47 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Glutamatom bogati protein 5 je protein koji je kod ljudi kodiran genom ERICH5, znan i kao otvoreni okvir čitanja 47 hromosoma 8 (C8orf47).

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 374 aminokiseline, а molekulska težina 39.936 Da.[5]

1020304050
MGCSSSALNKAGDSSRFPSVTSNEHFSTAEESESCFAQPKPHALGRESTV
DGNVQRESRPPLQKLKVSAEPTANGVKPLQEQPLAKDVAPGRDATDQSGS
TEKTQPGEGLEESGPPQPGGKEDAPAAEGKKKDAGAGTEAESLKGNAEAQ
PLGPEAKGQPLQAAVEKDSLRAVEVTENPQTAAEMKPLGTTENVLTLQIA
GELQPQGTVGKDEQAPLLETISKENESPEILEGSQFVETAEEQQLQATLG
KEEQPQLLERIPKENVTPEVLDRSQLVEKPVMNDPFHKTPEGPGNMEQIQ
PEGIVGSMEHPARNVEAGAYVEMIRNIHTNEEDQRIEGETGEKVETDMEN
EKVSEGAETKEEETGEVVDLSAAT

Gen[uredi | uredi izvor]

Gen ERICH5 se nalazi na ljudskom hromosomu 8 na 8q22.2 i prostire se na 29 kb na plus lancu DNK.[6] ERICH5 ima tri egzona i dva introna.[7] ERICH5 je takođe poznat kao C8orf47 i glutamatom bogati protein 5.[6]

Protein[uredi | uredi izvor]

Izoforme[uredi | uredi izvor]

Protein ERICH5 ima dvije izoforme. Najduža izoforma 1 obuhvata 1.550 parova baza i sastavljen je od 374 aminokiseline. Drugoj izoformi nedostaje treći i posljednji egzon, a dugačak je 596 parova baza.[7]

Domeni i motivi[uredi | uredi izvor]

ERICH5 sadrži jedan konzervirani domen, domen nepoznate funkcije koji se naziva DUF4573.[8] Predviđa se da ERICH5 sadrži dva visoko očuvana motiva, kompleks koji promovira anafazu (APC/C) vezujući motiv i motiv LIG_FHA_2.[9] Motiv APC/C obuhvata aminokiselina 222-226 i služi kao mjesto vezanja za kompleks koji promovira anafazu.[10] Motiv LIG_FHA_2 uključen je u put kontrolne ćelijske tačke i nalazi se u mnogim proteinima u jedru koji regulira ćelijski ciklus.[11]

Posttranslacijske modifikacije[uredi | uredi izvor]

Predviđa se da će ERICH5 proći kroz nekoliko posttranslacijskih modifikacija, uključujući fosforilaciju, O-vezanu glikozilaciju i sumolizaciju.[12][13][14] Mnoga mjesta fosforilacije i mjesta O-glikozilacije predviđena su na istoj aminokiselini. Prikazane posttranslacijske modifikacije su one konzervirane među ERICH5 ortolozima. Predviđeno je da nekoliko kinaza fosforilira ERICH5, uključujući PKC, cdc2, CKI, PKA, DNk PK, ATM, EGFR i CKII.[12]

Posttranslacijska modifikacija Lokacija aminokiselina
Fosforilacija S4, S5, S27, S32, S49, T50, S58, S100, T101, T104, T138, S169, S227, S234, T239,T248, S274, T289, S307,Y320, T340, T346
O-Glikozilacija S5,S27, S32, S49, T50, S58, S100, T101, T104, T138, S169, S227, S234, T239, T248, S274, T289,S307
Sumoilacija K121, K131, K211, K251, ,K343, K360

Sekundarna struktura[uredi | uredi izvor]

Predviđeno je da ERICH5 sadrži tri alfa-helikss i dva beta-lista, kao i područja nasumične zavojnice.[15]

Sekundarna struktura ERICH5[15]
Interakcije proteina ERICH5[16]

Subćelijska lokalizacija[uredi | uredi izvor]

Predviđeno je da je ERICH5 lokaliziran u jedru.[17]

Interakcije proteina[uredi | uredi izvor]

Predviđeno je da ERICH5 stupa u interakciju s nekoliko proteina preko dvohibridnog skrininga kvasca i afinitetne hromatografije.[16] Predviđeno je da je nekoliko proteina s kojima je ERICH5 stupio u interakciju također lokalizirano u jedru.[16]

Ekspresija[uredi | uredi izvor]

Normalna ekspresija gena ERICH5 i raznim tkivima[18]

Normalna ekspresija[uredi | uredi izvor]

ERICH5 pokazuje povišene nivoe ekspresije u fetusnoj jetri, jetri odraslih, gušterači i mrežnjači u poređenju sa drugim tkivima.

Ekspresija u bolesti
Ekspresija ERICH5 kod alkoholnog hepatitisa.[19]

ERICH5 pokazuje povećanu ekspresiju u alkoholnom hepatitisu.

Homologija[uredi | uredi izvor]

Paralozi[uredi | uredi izvor]

Ne postoje poznati paralozi ERICH5.[20]

Ortolozi[uredi | uredi izvor]

Pravi ortolozi ERICH5 identificirani su samo među vrstama sisara. Najdalji srodni ortolog sisara je Monodelphis domestica (sivi kratkorepi oposum).[21]

Rod i vrsta Uobičajeno ime Divergencija od ljudi (milioni godina) Sličnost Identitet Pristupni broj Dužina proteina
Acinonyx jubatus Gepard 96 71% 65% XP_014937513.1 358
Cerathotherium Bijeli nosorog 96 71% 66% XP_004431343.2 358
Trichechus manatus latirostris Morska krava 105 68% 59% XP_004370879.3 342
Monodelphis Sivi kratkorepi oposum 159 40% 28% XP_007488209.1 478

Udaljeni ortolozi[uredi | uredi izvor]

ERICH5 ima udaljene ortologe među pticama i gmizavcima. Ovi udaljeni ortolozi sadrže samo treći egzon ERICH5-a.[21]

Rod i vrsta Uobičajeno ime Divergencija od ljudi (milioni godina) Sličnost Identitet Pristupni broj Dužina proteina
Gallus gallus Kokoš 312 80% 64% XP_004940017.1 207
Chysemys picta belli Pjegava kornjača 312 74% 59% XP_008166572.1 442

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000177459 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000044726 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "UniProt, Q6P6B1" (jezik: engleski). Pristupljeno 16. 9. 2021.
  6. ^ a b Database, GeneCards Human Gene. "ERICH5 Gene - GeneCards | ERIC5 Protein | ERIC5 Antibody". www.genecards.org. Pristupljeno 1. 5. 2018.
  7. ^ a b "ERICH5 glutamate rich 5 [Homo sapiens (human)] - Gene - NCBI". www.ncbi.nlm.nih.gov. Pristupljeno 6. 5. 2018.
  8. ^ "NCBI Conserved Domain Search". www.ncbi.nlm.nih.gov. Pristupljeno 7. 5. 2018.
  9. ^ "ELM - unknown". elm.eu.org. Pristupljeno 7. 5. 2018.
  10. ^ "ELM - Detail for DEG_APCC_KENBOX_2". elm.eu.org (jezik: engleski). Pristupljeno 7. 5. 2018.
  11. ^ "ELM - Detail for LIG_FHA_2". elm.eu.org (jezik: engleski). Pristupljeno 7. 5. 2018.
  12. ^ a b "NetPhos 3.1 Server - prediction results". www.cbs.dtu.dk. Arhivirano s originala, 7. 5. 2018. Pristupljeno 7. 5. 2018.
  13. ^ "NetOGlyc 4.0 Server - prediction results". www.cbs.dtu.dk. Arhivirano s originala, 7. 5. 2018. Pristupljeno 7. 5. 2018.
  14. ^ "GPS-SUMO: Prediction of SUMOylation Sites & SUMO-interaction Motifs". sumosp.biocuckoo.org. Arhivirano s originala, 6. 5. 2018. Pristupljeno 7. 5. 2018.
  15. ^ a b "Result for job ERICH5". raptorx.uchicago.edu. Pristupljeno 7. 5. 2018.[mrtav link]
  16. ^ a b c "PSICQUIC View". EMBL-EBI.
  17. ^ "PSORTII". PSORTII.[trajno mrtav link]
  18. ^ Dezso Z, Nikolsky Y, Sviridov E, Shi W, Serebriyskaya T, Dosymbekov D, et al. (novembar 2008). "A comprehensive functional analysis of tissue specificity of human gene expression". BMC Biology. 6: 49. doi:10.1186/1741-7007-6-49. PMC 2645369. PMID 19014478.
  19. ^ "Transcriptome analysis identifies TNF superfamily receptors as potential therapeutic targets in alcoholic hepatitis".
  20. ^ "Gene: ERICH5 (ENSG00000177459) - Comparative Genomics - Homo sapiens - Ensembl genome browser 92". useast.ensembl.org (jezik: engleski). Pristupljeno 7. 5. 2018.
  21. ^ a b "BLAST: Basic Local Alignment Search Tool". blast.ncbi.nlm.nih.gov. Pristupljeno 7. 5. 2018.