ESPN

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
ESPN
Identifikatori
Aliasi
Vanjski ID-jeviGeneCards: [1]
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

n/a

n/a

RefSeq (bjelančevina)

n/a

n/a

Lokacija (UCSC)n/an/a
PubMed pretragan/an/a
Wikipodaci
Pogledaj/uredi – čovjek

Espin, poznat i kao protein 36 autosomno recesivne gluhoće tipa 36 ili protein ektoplazmatske specializacije, jest protein koji je kod ljudi kodiran genom ESPN sa hromosoma 1.[1] Espin je mikrofilament-vezujući protein.

Amiokiselininska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 854 aminokiseline, a molekulska težina Da. 91 733[2]

1020304050
MALEQALQAARQGELDVLRSLHAAGLLGPSLRDPLDALPVHHAARAGKLH
CLRFLVEEAALPAAARARNGATPAHDASATGHLACLQWLLSQGGCRVQDK
DNSGATVLHLAARFGHPEVVNWLLHHGGGDPTAATDMGALPIHYAAAKGD
FPSLRLLVEHYPEGVNAQTKNGATPLYLACQEGHLEVTQYLVQECGADPH
ARAHDGMTPLHAAAQMGHSPVIVWLVSCTDVSLSEQDKDGATAMHFAASR
GHTKVLSWLLLHGGEISADLWGGTPLHDAAENGELECCQILVVNGAELDV
RDRDGYTAADLSDFNGHSHCTRYLRTVENLSVEHRVLSRDPSAELEAKQP
DSGMSSPNTTVSVQPLNFDLSSPTSTLSNYDSCSSSHSSIKGQHPPCGLS
SARAADIQSYMDMLNPELGLPRGTIGKPTPPPPPPSFPPPPPPPGTQLPP
PPPGYPAPKPPVGPQAADIYMQTKNKLRHVETEALKKELSSCDGHDGLRR
QDSSRKPRAFSKQPSTGDYYRQLGRCPGETLAARPGMAHSEEVRARQPAR
AGCPRLGPAARGSLEGPSAPPQAALLPGNHVPNGCAADPKASRELPPPPP
PPPPPLPEAASSPPPAPPLPLESAGPGCGQRRSSSSTGSTKSFNMMSPTG
DNSELLAEIKAGKSLKPTPQSKGLTTVFSGIGQPAFQPDSPLPSVSPALS
PVRSPTPPAAGFQPLLNGSLVPVPPTTPAPGVQLDVEALIPTHDEQGRPI
PEWKRQVMVRKMQLKMQEEEEQRRKEEEEEARLASMPAWRRDLLRKKLEE
EREQKRKEEERQKQEELRREKEQSEKLRTLGYDESKLAPWQRQVILKKGD
IAKY

Funkcija[uredi | uredi izvor]

Espin je multifunkcionalni protein koji povezuje aktin. Ima glavnu ulogu u regulaciji organizacije, dimenzija, dinamike i signalnih kapaciteta specijalizacija tipa mikrovilusa bogatih aktinskim filamentima koji posreduju u senzornoj transdukciji u različitim mehanosenzornim i hemosenzornim ćelijama.[1]

Klinički značaj[uredi | uredi izvor]

Mutacije ovog gena su povezane sa autosomno recesivnom neurosenzornom gluhoćom, autosomno dominantnom senzornervnom gluhoćom bez vestibulnog zahvata i DFNB36.[1]

Reference[uredi | uredi izvor]

  1. ^ a b c "Entrez Gene: espin".
  2. ^ "UniProt, B1AK53" (jezik: engleski). Pristupljeno 25. 11. 2021.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]

Ovaj članak uključuje tekst iz Nacionalne medicinske biblioteke Sjedinjenih Država, koji je u javnom vlasništvu.