FASTKD5

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
FASTKD5
Identifikatori
AliasiFASTKD5
Vanjski ID-jeviOMIM: 614272 MGI: 2139469 HomoloGene: 36400 GeneCards: FASTKD5
Lokacija gena (čovjek)
Hromosom 20 (čovjek)
Hrom.Hromosom 20 (čovjek)[1]
Hromosom 20 (čovjek)
Genomska lokacija za FASTKD5
Genomska lokacija za FASTKD5
Bend20p13Početak3,146,519 bp[1]
Kraj3,159,865 bp[1]
Lokacija gena (miš)
Hromosom 2 (miš)
Hrom.Hromosom 2 (miš)[2]
Hromosom 2 (miš)
Genomska lokacija za FASTKD5
Genomska lokacija za FASTKD5
Bend2|2 F1Početak130,613,840 bp[2]
Kraj130,630,027 bp[2]
Ontologija gena
Molekularna funkcija protein kinase activity
rRNA binding
GO:0001948 protein binding
RNA binding
Ćelijska komponenta ribonucleoprotein granule
mitochondrial nucleoid
mitohondrija
Biološki proces Ćelijsko disanje
protein phosphorylation
mRNA processing
mitochondrial RNA processing
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_021826

NM_001146084
NM_198176
NM_001377124
NM_001377125

RefSeq (bjelančevina)

NP_068598

NP_001139556
NP_937819
NP_001364053
NP_001364054

Lokacija (UCSC)Chr 20: 3.15 – 3.16 MbChr 2: 130.61 – 130.63 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

FAST kinazni domen-sadržavajući protein 5 (FASTKD5) je protein koji je kod ljudi kodiran genom FASTKD5 sa hromosoma 20.[5][6]

Ovaj protein je dio porodice FASTKD, koja je poznata po tome što regulira energetsku ravnotežu mitohondrija pod stresom.[7][8] FASTKD5 je također potreban i granulama RNK za obradu prekursorskih iRNK, koje nisu uz bok tRNK.[9]

Struktura[uredi | uredi izvor]

FASTKD5 dijeli strukturne karakteristike porodice FASTKD, uključujući amino terminalni domen za ciljanje mitohondrija i tri domena C-kraja: dva FAST domena slična kinazi (FAST_1 i FAST_2) i domen koji veže RNK (RAP).[7][8] Domen ciljanja mitohondrija usmjerava FASTKD5 na unos u mitohondrije. Iako su funkcije C-krajevih domena nepoznate, RAP vjerovatno veže RNK tpkom trans-prerade.[7] Ovaj protein tvori proteinski kompleks od 103 kDa s neidentificiranim proteinima.[9]

Aminokiselinska sekvenca

MAATLKSLKLVRYRAFCSPSAFGAVRSVSYWNVSSTQHGGQDPPEHISLC HSAKKVKNICSTFSSRRILTTSSAHPGLEFSKTSSSKASTLQLGSPRATG VDEEDVEVFDSFENMRVFLQLRPEYRVHSYNASETSQLLSVSEGELILHK VRVNQNNLQAQVIVDYLCKLSSLPAEQHPVLLGSTSFALLCQLSVKKIQL FDTQDLINVLKAFVILGIPHSHSMLDVYETKCCHQVWEMNMDQLLLVADL WRYLGRKVPRFLNIFSSYLNLHWKDLSLSQLVHLIYVIGENRQVSQDLMQ KLESLILKYIDLINLEEVGTICLGFFKSSTNLSEFVMRKIGDLACANIQH LSSRSLVNIVKMFRFTHVDHINFMKQIGEIAPQRIPSLGVQGVMHLTLYC SALRFLNEGVMNAVAASLPPRVAHCRSKDVAKILWSFGTLNYKPPNAEEF YSSLISEIHRKMPEFNQYPEHLPTCLLGLAFLEYFPVELIDFALSPGFVR LAQERTKFDLLKELYTLDGTVGIECPDYRGNRLSTHLQQEGSELLWYLAE KDMNSKPEFLETVFLLETMLGGPQYVKHHMILPHTRSSDLEVQLDVNLKP LPFNREATPAENVAKLRLEHVGVSLTDDLMNKLLKGKARGHFQGKTESEP GQQPMELENKAAVPLGGFLCNVADKSGAMEMAGLCPAACMQTPRMKLAVQ FTNRNQYCYGSRDLLGLHNMKRRQLARLGYRVVELSYWEWLPLLKRTRLE KLAFLHEKVFTSAL

O: Alanin
C: Cistein
D: Asparaginska kiselina
E: Glutaminska kiselina
F: Fenilalanin
G: Glicin
H: Histidin
I: izoleucin
K: Lizin
L: Leucin
M: Metionin
N: Asparagin
P: Prolin
P: Glutamin
R: Arginin
S: Serin
T: Treonin
V: Valin
W: Triptofan

Y: Tirozin

Protein kodiran ovim genom po funkciji pripada fosfoproteinima.

Uključen u takve biološke procese kao prerada iRNK i acetilacija.

Protein ima mjesto za vezanje za RNK, rRNK. Lokalizirano u mitohondrijama i njihovim nukleoidima.

Funkcija[uredi | uredi izvor]

Kao član porodice FASTKD, FASTKD5 se lokalizuje u mitohondrijama radi modulacije njihove energetske ravnoteže, posebno u uvjetima stresa. Iako se posvuda eksprimira u svim tkivima, FASTKD5 se obilnije pojavljuje u skeletnim mišićima, srčanom mišiću i drugim tkivima bogatim mitohondrijama.[7] FASTKD5 se također lokalizira u granulama RNK, bez membranskih tijela koja sadrže iRNK i pridruženim proteiniima koji vežu RNK, gdje olakšava posttranskripcijsku obradu RNK. Ovaj protein potreban je za sazrijevanje prekursorskih iRNK, koje nisu flankirane putem tRNK, pa se stoga ne mogu obraditi kanonskim putem sazrijevanja iRNK.[9]

Klinički značaj[uredi | uredi izvor]

Iako veza s FASTKD5 ostaje neokarakterizirana, nakupljanje abnormalnih granula RNK može dovesti do nekih neurodegenerativnih bolesti.[9]

Interakcije[uredi | uredi izvor]

Pokazano je da FASTKD5 ima interakcije sa:

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000215251 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000079043 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ UniProt: Šablon:UniProt
  6. ^ "Entrez Gene: FAST kinase domains 5".
  7. ^ a b c d Simarro M, Gimenez-Cassina A, Kedersha N, Lazaro JB, Adelmant GO, Marto JA, Rhee K, Tisdale S, Danial N, Benarafa C, Orduña A, Anderson P (Oct 2010). "Fast kinase domain-containing protein 3 is a mitochondrial protein essential for cellular respiration". Biochemical and Biophysical Research Communications. 401 (3): 440–6. doi:10.1016/j.bbrc.2010.09.075. PMC 2963690. PMID 20869947.
  8. ^ a b Yeung KT, Das S, Zhang J, Lomniczi A, Ojeda SR, Xu CF, Neubert TA, Samuels HH (Jun 2011). "A novel transcription complex that selectively modulates apoptosis of breast cancer cells through regulation of FASTKD2". Molecular and Cellular Biology. 31 (11): 2287–98. doi:10.1128/MCB.01381-10. PMC 3133243. PMID 21444724.
  9. ^ a b c d e f g Antonicka H, Shoubridge EA (Feb 2015). "Mitochondrial RNA Granules Are Centers for Posttranscriptional RNA Processing and Ribosome Biogenesis". Cell Reports. 10 (6): 920–932. doi:10.1016/j.celrep.2015.01.030. PMID 25683715.