Faktor XI

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
F11
Protein F11 PDB 1xx9.png
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1XX9, 1XXD, 1XXF, 1ZHM, 1ZHP, 1ZHR, 1ZJD, 1ZLR, 1ZMJ, 1ZML, 1ZMN, 1ZOM, 1ZPB, 1ZPC, 1ZPZ, 1ZRK, 1ZSJ, 1ZSK, 1ZSL, 1ZTJ, 1ZTK, 1ZTL, 2F83, 2FDA, 2J8J, 2J8L, 3BG8, 3SOR, 3SOS, 4CR5, 4CR9, 4CRA, 4CRB, 4CRC, 4CRD, 4CRE, 4CRF, 4CRG, 4NA7, 4NA8, 4TY6, 4TY7, 4WXI, 4X6M, 4X6N, 4X6O, 4X6P, 4Y8X, 4Y8Y, 4Y8Z, 4D7F, 5E2O, 5E2P, 4D76, 4D7G, 5EXL, 5I25, 5EXM, 5EOD, 5EXN, 5EOK

Identifikatori
AliasiF11
Vanjski ID-jeviOMIM: 264900 MGI: 99481 HomoloGene: 86654 GeneCards: F11
Lokacija gena (čovjek)
Hromosom 4 (čovjek)
Hrom.Hromosom 4 (čovjek)[1]
Hromosom 4 (čovjek)
Genomska lokacija za F11
Genomska lokacija za F11
Bend4q35.2Početak186,266,189 bp[1]
Kraj186,289,681 bp[1]
Lokacija gena (miš)
Hromosom 8 (miš)
Hrom.Hromosom 8 (miš)[2]
Hromosom 8 (miš)
Genomska lokacija za F11
Genomska lokacija za F11
Bend8 B1.1|8 25.14 cMPočetak45,694,211 bp[2]
Kraj45,715,068 bp[2]
Obrazac RNK ekspresije
PBB GE F11 206610 s at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija serine-type aminopeptidase activity
peptidase activity
heparin binding
serine-type endopeptidase activity
serine-type peptidase activity
GO:0001948 protein binding
hydrolase activity
identical protein binding
Ćelijska komponenta extracellular region
Ćelijska membrana
Egzosom
membrana
Vanćelijsko
Biološki proces Hemostaza
blood coagulation, intrinsic pathway
plasminogen activation
regulation of blood coagulation
Proteoliza
positive regulation of fibrinolysis
blood coagulation
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_000128
NM_019559
NM_001354804

NM_028066

RefSeq (bjelančevina)

NP_000119
NP_001341733

NP_082342

Lokacija (UCSC)Chr 4: 186.27 – 186.29 MbChr 8: 45.69 – 45.72 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Faktor XI ili plazmatski tromboplastinski prethodnik jest protein koji je kod ljudi kodiran genom F11 sa hromosoma 4. To je zimogeni oblik faktora XIa, jedan od enzima u koagulacijskoj kaskadi. Kao i mnogi drugi faktori koagulacije, to je serin-proteaza.[5][6][7][8]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 625 aminokiselina, а molekulska težina 70 109 Da.[9]

1020304050
MIFLYQVVHFILFTSVSGECVTQLLKDTCFEGGDITTVFTPSAKYCQVVC
TYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSF
KQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFT
YATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLAC
IRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKES
QRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTD
FLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKL
SSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPRIVGGTASVRGEWP
WQVTLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSGILN
QSEIKEDTSFFGVQEIIIHDQYKMAESGYDIALLKLETTVNYTDSQRPIC
LPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYR
GHKITHKMICAGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCA
QRERPGVYTNVVEYVDWILEKTQAV

Struktura[uredi | uredi izvor]

Iako je sintetiziran kao jedan polipeptidni lanac, FXI cirkulira kao homodimer. Svaki lanac ima relativnu molekulsku masu od približno 80.000. Tipske koncentracije FXI u plazmi su 5 μg/mL, što odgovara koncentraciji dimera FXI u plazmi od približno 30 nM. Na hromosomu 4, gen FXI je dug 23 kb, ima 15 egzona u regiji 4q32-35.[6][7]

Faktor XI se sastoji od četiri PAN-domena, koji stvaraju platformu nalik na disk oko baze 5., domena katalitske serin-proteaze. Jedan sadrži mjesto vezanja za trombin, drugi za kininogen visoke molekulske težine, treći za faktor IX, heparin i glikoprotein Ib, a četvrti je uključen u formiranje homodimera faktora XI, uključujući cisteinski ostatak koji stvara disulfidnu vezu.

U homodimeru, domeni PAN stvaraju dvije diskoidne platforme, povezane zajedno pod uglom, pri čemu katalitski domeni strše sa svake strane dimera.

Aktivacija trombinom ili faktorom XIIa se postiže cijepanjem Arg369-Ile370 peptidnih veza na obje podjedinice dimera. Ovo rezultira djelimičnim odvajanjem katalitskog domena od diskolikih domena PAN, još uvijek vezanih za četvrti domen disulfidnom vezom, ali sada dalje od trećeg domena.

Smatra se da ovo otkriva mjesto vezanja faktora IX trećeg PAN domena, omogućavajući proteazno delovanje faktora XI na njemu.[10]

Funkcija[uredi | uredi izvor]

Faktor XI (FXI) proizvodi jetra i cirkulira kao homodimer u svom neaktivnom obliku.[11] Poluvrijeme eliminacije FXI u plazmi je približno 52 sata. Zimogeni faktor aktivira se u faktor XIa, pomoću faktora XIIa (FXIIa), trombina i samog FXIa; zbog svoje aktivacije pomoću FXIIa, FXI je član "kontaktnog puta" (koji uključuje HMWK, prekalikrein, faktor XII, faktor XI i faktor IX).[12]

Faktor XIa aktivira faktor IX selektivnim cijepanjem arg-ala i arg-val peptidne veze . Faktor IXa, zauzvrat, formira kompleks sa faktorom VIIIa (FIXa-FVIIIa) i aktivira faktor X.

Inhibitori faktora XIa uključuju protein Z-ovisni inhibitor proteaze (ZPI, član inhibitor serin proteaze/serpin klase proteina), koji je nezavisan od proteina Z (njegovo djelovanje na faktor X, međutim, zavisi od proteina Z, otuda i njegovo ime).

Klinički značaj[uredi | uredi izvor]

Nedostatak faktora XI uzrokuje rijetku hemofiliju C; ovo se uglavnom dešava kod Aškenazi Jevreja i vjeruje se da pogađa otprilike 8% te populacije. ]]Rjeđe, hemofilija C može se naći kod Jevreja iračkog porijekla i kod izraelskih Arapa. Stanje je opisano u drugim populacijama u oko 1% slučajeva. To je autosomno recesivni poremećaj. Spontanog krvarenja je malo, ali hirurški zahvati mogu uzrokovati prekomjeran gubitak krvi i potrebna je profilaksa.[13]

Nizak nivo faktora XI se takođe javlja u mnogim drugim bolesnim stanjima, uključujući Noonanov sindrom.

Visoki nivoi faktora XI su uključeni u trombozu, iako je neizvjesno šta određuje ove nivoe i koliko je ozbiljno prokoagulantno stanje.

Također pogledajte[uredi | uredi izvor]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000088926 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000031645 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Šablon:EVC.PNGcite journal
  6. ^ a b Asakai R, Davie EW, Chung DW (Nov 1987). "Organization of the gene for human factor XI". Biochemistry. 26 (23): 7221–8. doi:10.1021/bi00397a004. PMID 2827746.
  7. ^ a b Kato A, Asakai R, Davie EW, Aoki N (1989). "Factor XI gene (F11) is located on the distal end of the long arm of human chromosome 4". Cytogenetics and Cell Genetics. 52 (1–2): 77–8. doi:10.1159/000132844. PMID 2612218.
  8. ^ Buetow KH, Shiang R, Yang P, Nakamura Y, Lathrop GM, White R, Wasmuth JJ, Wood S, Berdahl LD, Leysens NJ (maj 1991). "A detailed multipoint map of human chromosome 4 provides evidence for linkage heterogeneity and position-specific recombination rates". American Journal of Human Genetics. 48 (5): 911–25. PMC 1683054. PMID 1673289.
  9. ^ "UniProt, P03951" (jezik: engleski). Pristupljeno 26. 10. 2021.
  10. ^ Emsley J, McEwan PA, Gailani D (Apr 2010). "Structure and function of factor XI". Blood. 115 (13): 2569–77. doi:10.1182/blood-2009-09-199182. PMC 4828079. PMID 20110423.
  11. ^ Wu W, Sinha D, Shikov S, Yip CK, Walz T, Billings PC, Lear JD, Walsh PN (Jul 2008). "Factor XI homodimer structure is essential for normal proteolytic activation by factor XIIa, thrombin, and factor XIa". The Journal of Biological Chemistry. 283 (27): 18655–64. doi:10.1074/jbc.M802275200. PMC 2441546. PMID 18441012.
  12. ^ Walsh PN (Jul 2001). "Roles of platelets and factor XI in the initiation of blood coagulation by thrombin". Thrombosis and Haemostasis. 86 (1): 75–82. doi:10.1055/s-0037-1616203. PMID 11487044. Arhivirano s originala, 16. 4. 2016. Pristupljeno 7. 1. 2009.
  13. ^ Bolton-Maggs PH (Jun 1996). "Factor XI deficiency". Baillière's Clinical Haematology. 9 (2): 355–68. doi:10.1016/S0950-3536(96)80068-0. PMID 8800510.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]

  • The MEROPS online database for peptidases and their inhibitors: S01.213