GLMN

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
GLMN
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

4F52

Identifikatori
AliasiGLMN
Vanjski ID-jeviOMIM: 601749 MGI: 2141180 HomoloGene: 14239 GeneCards: GLMN
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za GLMN
Genomska lokacija za GLMN
Bend1p22.1Početak92,246,402 bp[1]
Kraj92,298,987 bp[1]
Lokacija gena (miš)
Hromosom 5 (miš)
Hrom.Hromosom 5 (miš)[2]
Hromosom 5 (miš)
Genomska lokacija za GLMN
Genomska lokacija za GLMN
Bend5|5 E5Početak107,548,967 bp[2]
Kraj107,597,888 bp[2]
Obrazac RNK ekspresije
PBB GE GLMN 207153 s at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija ubiquitin-protein transferase inhibitor activity
GO:0001948 protein binding
ubiquitin protein ligase binding
hepatocyte growth factor receptor binding
Ćelijska komponenta Cul4A-RING E3 ubiquitin ligase complex
Cul2-RING ubiquitin ligase complex
cullin-RING ubiquitin ligase complex
Cul3-RING ubiquitin ligase complex
intracellular anatomical structure
citoplazma
Biološki proces Vaskulogeneza
muscle cell differentiation
negative regulation of T cell proliferation
neural tube closure
positive regulation of phosphorylation
circulatory system development
regulation of gene expression, epigenetic
regulation of proteasomal ubiquitin-dependent protein catabolic process
negative regulation of protein ubiquitination
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_007070
NM_053274
NM_001319683

NM_001161738
NM_001161739
NM_133248

RefSeq (bjelančevina)

NP_001306612
NP_444504

NP_001155210
NP_001155211
NP_573511

Lokacija (UCSC)Chr 1: 92.25 – 92.3 MbChr 5: 107.55 – 107.6 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Glomulin jest protein koji je kod ljudi kodiran genom GLMN sa hromosoma 1.[5][6]

Aminokiselininska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 594 aminokiseline, a molekulska težina 68 208 Da. [7].

1020304050
MAVEELQSIIKRCQILEEQDFKEEDFGLFQLAGQRCIEEGHTDQLLEIIQ
NEKNKVIIKNMGWNLVGPVVRCLLCKDKEDSKRKVYFLIFDLLVKLCNPK
ELLLGLLELIEEPSGKQISQSILLLLQPLQTVIQKLHNKAYSIGLALSTL
WNQLSLLPVPYSKEQIQMDDYGLCQCCKALIEFTKPFVEEVIDNKENSLE
NEKLKDELLKFCFKSLKCPLLTAQFFEQSEEGGNDPFRYFASEIIGFLSA
IGHPFPKMIFNHGRKKRTWNYLEFEEEENKQLADSMASLAYLVFVQGIHI
DQLPMVLSPLYLLQFNMGHIEVFLQRTEESVISKGLELLENSLLRIEDNS
LLYQYLEIKSFLTVPQGLVKVMTLCPIETLRKKSLAMLQLYINKLDSQGK
YTLFRCLLNTSNHSGVEAFIIQNIKNQIDMSLKRTRNNKWFTGPQLISLL
DLVLFLPEGAETDLLQNSDRIMASLNLLRYLVIKDNENDNQTGLWTELGN
IENNFLKPLHIGLNMSKAHYEAEIKNSQEAQKSKDLCSITVSGEEIPNMP
PEMQLKVLHSALFTFDLIESVLARVEELIEIKTKSTSEENIGIK

Funkcija[uredi | uredi izvor]

Ovaj gen kodira fosforilirani protein koji je član Skp1-kulin-F-kutijskog kompleksa. Protein je neophodan za normalan razvoj vaskulature; mutacije ovog gena povezane su sa glomuvenoznim malformacijama, koje se takođe nazivaju glomangiomi. Opisane su alternativno prerađene varijante koje kodiraju različite izoforme proteina, ali je određena priroda pune dužine samo jednog.[6]

Interakcije[uredi | uredi izvor]

Pokazalo se da je GLMN u interakciji sa FKBP4,[5][8] C-Met[9] i FKBP1A.[5][8]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000174842 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000029276 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b c Chambraud B, Radanyi C, Camonis JH, Shazand K, Rajkowski K, Baulieu EE (Jan 1997). "FAP48, a new protein that forms specific complexes with both immunophilins FKBP59 and FKBP12. Prevention by the immunosuppressant drugs FK506 and rapamycin". J Biol Chem. 271 (51): 32923–9. doi:10.1074/jbc.271.51.32923. PMID 8955134.
  6. ^ a b "Entrez Gene: GLMN glomulin, FKBP associated protein".
  7. ^ "UniProt, Q92990" (jezik: eng.). Pristupljeno 2021-11-28. CS1 održavanje: nepreporučeni parametar (link) CS1 održavanje: nepoznati jezik (link)
  8. ^ a b Neye, H (Mar 2001). "Mutation of FKBP associated protein 48 (FAP48) at proline 219 disrupts the interaction with FKBP12 and FKBP52". Regul. Pept. Netherlands. 97 (2–3): 147–52. doi:10.1016/S0167-0115(00)00206-8. ISSN 0167-0115. PMID 11164950. S2CID 20617551.
  9. ^ Grisendi, S; Chambraud B; Gout I; Comoglio P M; Crepaldi T (Dec 2001). "Ligand-regulated binding of FAP68 to the hepatocyte growth factor receptor". J. Biol. Chem. United States. 276 (49): 46632–8. doi:10.1074/jbc.M104323200. ISSN 0021-9258. PMID 11571281.

Dopunska literatura[uredi | uredi izvor]