GLTSCR2

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
GLTSCR2
Identifikatori
AliasiNOP53
Vanjski ID-jeviOMIM: 605691 MGI: 2154441 HomoloGene: 44130 GeneCards: NOP53
Lokacija gena (čovjek)
Hromosom 19 (čovjek)
Hrom.Hromosom 19 (čovjek)[1]
Hromosom 19 (čovjek)
Genomska lokacija za GLTSCR2
Genomska lokacija za GLTSCR2
Bend19q13.33Početak47,745,546 bp[1]
Kraj47,757,058 bp[1]
Ontologija gena
Molekularna funkcija RNA binding
5S rRNA binding
GO:0001948 protein binding
p53 binding
identical protein binding
Ćelijska komponenta intracellular anatomical structure
intracellular membrane-bounded organelle
Jedro
Jedarce
citosol
fibrillar center
rDNA heterochromatin
Nukleoplazma
Biološki proces ribosomal large subunit assembly
regulation of protein phosphorylation
protein stabilization
regulation of signal transduction by p53 class mediator
negative regulation of signal transduction by p53 class mediator
regulation of aerobic respiration
ribosomal large subunit export from nucleus
negative regulation of transcription by RNA polymerase II
Popravka DNK
mitotic G2 DNA damage checkpoint signaling
negative regulation of phosphatidylinositol 3-kinase signaling
negative regulation of protein-containing complex assembly
negative regulation of proteasomal ubiquitin-dependent protein catabolic process
positive regulation of proteasomal ubiquitin-dependent protein catabolic process
regulation of apoptotic process
regulation of cell cycle
cellular response to hypoxia
protein localization to nucleolus
protein localization to nucleoplasm
cellular response to DNA damage stimulus
regulation of RIG-I signaling pathway
negative regulation of protein kinase B signaling
negative regulation of transcription of nucleolar large rRNA by RNA polymerase I
positive regulation of protein K63-linked deubiquitination
ribosome biogenesis
rRNA processing
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_015710

NM_133831

RefSeq (bjelančevina)

NP_056525

NP_598592

Lokacija (UCSC)Chr 19: 47.75 – 47.76 Mbn/a
PubMed pretraga[2][3]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Proteinski kandidat regije gena-2 gliomskog supresora je protein koji je kod ljudi kodiran genom GLTSCR2.[4][5][6][7]

Aminokiselinska sekcenca

Simboli
1020304050
MAAGGSGVGGKRSSKSDADSGFLGLRPTSVDPALRRRRRGPRNKKRGWRR
LAQEPLGLEVDQFLEDVRLQERTSGGLLSEAPNEKLFFVDTGSKEKGLTK
KRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKEQ
LWEKLAKQGELPREVRRAQARLLNPSATRAKPGPQDTVERPFYDLWASDN
PLDRPLVGQDEFFLEQTKKKGVKRPARLHTKPSQAPAVEVAPAGASYNPS
FEDHQTLLSAAHEVELQRQKEAEKLERQLALPATEQAATQESTFQELCEG
LLEESDGEGEPGQGEGPEAGDAEVCPTPARLATTEKKTEQQRRREKAVHR
LRVQQAALRAARLRHQELFRLRGIKAQVALRLAELARRQRRRQARREAEA
DKPRRLGRLKYQAPDIDVQLSSELTDSLRTLKPEGNILRDRFKSFQRRNM
IEPRERAKFKRKYKVKLVEKRAFREIQL

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000105373 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ Smith JS, Tachibana I, Pohl U, Lee HK, Thanarajasingam U, Portier BP, Ueki K, Ramaswamy S, Billings SJ, Mohrenweiser HW, Louis DN, Jenkins RB (Jun 2000). "A transcript map of the chromosome 19q-arm glioma tumor suppressor region". Genomics. 64 (1): 44–50. doi:10.1006/geno.1999.6101. PMID 10708517.
  5. ^ Okahara F, Itoh K, Nakagawara A, Murakami M, Kanaho Y, Maehama T (Oct 2006). "Critical role of PICT-1, a tumor suppressor candidate, in phosphatidylinositol 3,4,5-trisphosphate signals and tumorigenic transformation". Mol Biol Cell. 17 (11): 4888–95. doi:10.1091/mbc.E06-04-0301. PMC 1635402. PMID 16971513.
  6. ^ Yim JH, Kim YJ, Ko JH, Cho YE, Kim SM, Kim JY, Lee S, Park JH (Oct 2007). "The putative tumor suppressor gene GLTSCR2 induces PTEN-modulated cell death". Cell Death Differ. 14 (11): 1872–9. doi:10.1038/sj.cdd.4402204. PMID 17657248.
  7. ^ "Entrez Gene: GLTSCR2 glioma tumor suppressor candidate region gene 2".

Dopunska literatura[uredi | uredi izvor]