HAUS1

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
HAUS1
Identifikatori
AliasiHAUS1
Vanjski ID-jeviOMIM: 608775 MGI: 2385076 HomoloGene: 15516 GeneCards: HAUS1
Lokacija gena (čovjek)
Hromosom 18 (čovjek)
Hrom.Hromosom 18 (čovjek)[1]
Hromosom 18 (čovjek)
Genomska lokacija za HAUS1
Genomska lokacija za HAUS1
Bend18q21.1Početak46,104,378 bp[1]
Kraj46,128,333 bp[1]
Lokacija gena (miš)
Hromosom 18 (miš)
Hrom.Hromosom 18 (miš)[2]
Hromosom 18 (miš)
Genomska lokacija za HAUS1
Genomska lokacija za HAUS1
Bend18|18 E3Početak77,757,567 bp[2]
Kraj77,767,780 bp[2]
Ontologija gena
Molekularna funkcija GO:0001948 protein binding
molecular function
Ćelijska komponenta centar organizacije mikrotubula
centrosom
Diobeno vreteno
spindle pole
Mikrotubula
HAUS complex
citoskelet
citoplazma
citosol
Biološki proces spindle assembly
Ćelijski ciklus
Ćelijska dioba
G2/M transition of mitotic cell cycle
ciliary basal body-plasma membrane docking
centrosome cycle
regulation of G2/M transition of mitotic cell cycle
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_138443

NM_146089
NM_001357531
NM_001357532
NM_001357533

RefSeq (bjelančevina)

NP_612452

NP_666201
NP_001344460
NP_001344461
NP_001344462

Lokacija (UCSC)Chr 18: 46.1 – 46.13 MbChr 18: 77.76 – 77.77 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Podjedinica 1 HAUS augminolikog kompleksa je protein koji je kod ljudi kodiran genom HAUS1.[5][6][7]

Dužina polipeptidnog lanca je 278 Aminokiselina, a molekulska masa je — 31.863[8].

Aminokiselinska sekvenca

Simboli
1020304050
MEPQEERETQVAAWLKKIFGDHPIPQYEVNPRTTEILHHLSERNRVRDRD
VYLVIEDLKQKASEYESEAKYLQDLLMESVNFSPANLSSTGSRYLNALVD
SAVALETKDTSLASFIPAVNDLTSDLFRTKSKSEEIKIELEKLEKNLTAT
LVLEKCLQEDVKKAELHLSTERAKVDNRRQNMDFLKAKSEEFRFGIKAAE
EQLSARGMDASLSHQSLVALSEKLARLKQQTIPLKKKLESYLDLMPNPSL
AQVKIEEAKRELDSIEAELTRRVDMMEL

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000152240 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000041840 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Strausberg RL, Feingold EA, Grouse LH, Derge JG, Klausner RD, Collins FS, Wagner L, Shenmen CM, Schuler GD, Altschul SF, Zeeberg B, Buetow KH, Schaefer CF, Bhat NK, Hopkins RF, Jordan H, Moore T, Max SI, Wang J, Hsieh F, Diatchenko L, Marusina K, Farmer AA, Rubin GM, Hong L, Stapleton M, Soares MB, Bonaldo MF, Casavant TL, Scheetz TE, Brownstein MJ, Usdin TB, Toshiyuki S, Carninci P, Prange C, Raha SS, Loquellano NA, Peters GJ, Abramson RD, Mullahy SJ, Bosak SA, McEwan PJ, McKernan KJ, Malek JA, Gunaratne PH, Richards S, Worley KC, Hale S, Garcia AM, Gay LJ, Hulyk SW, Villalon DK, Muzny DM, Sodergren EJ, Lu X, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madan A, Young AC, Shevchenko Y, Bouffard GG, Blakesley RW, Touchman JW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Krzywinski MI, Skalska U, Smailus DE, Schnerch A, Schein JE, Jones SJ, Marra MA (Dec 2002). "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences". Proc Natl Acad Sci U S A. 99 (26): 16899–903. doi:10.1073/pnas.242603899. PMC 139241. PMID 12477932.
  6. ^ Lawo S, Bashkurov M, Mullin M, Ferreria MG, Kittler R, Habermann B, Tagliaferro A, Poser I, Hutchins JR, Hegemann B, Pinchev D, Buchholz F, Peters JM, Hyman AA, Gingras AC, Pelletier L (maj 2009). "HAUS, the 8-subunit human Augmin complex, regulates centrosome and spindle integrity". Curr Biol. 19 (10): 816–26. doi:10.1016/j.cub.2009.04.033. PMID 19427217. S2CID 2893122.
  7. ^ "Entrez Gene: CCDC5 coiled-coil domain containing 5 (spindle associated)".
  8. ^ "UniProt, Q96CS2". Pristupljeno 12. 9. 2017.

Vanjski linkovi[uredi | uredi izvor]

Dopunska literatura[uredi | uredi izvor]