HCST

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
HCST
Identifikatori
AliasiHCST
Vanjski ID-jeviOMIM: 604089 MGI: 1344360 HomoloGene: 8024 GeneCards: HCST
Lokacija gena (čovjek)
Hromosom 19 (čovjek)
Hrom.Hromosom 19 (čovjek)[1]
Hromosom 19 (čovjek)
Genomska lokacija za HCST
Genomska lokacija za HCST
Bend19q13.12Početak35,902,529 bp[1]
Kraj35,904,377 bp[1]
Lokacija gena (miš)
Hromosom 7 (miš)
Hrom.Hromosom 7 (miš)[2]
Hromosom 7 (miš)
Genomska lokacija za HCST
Genomska lokacija za HCST
Bend7 B1|7 17.45 cMPočetak30,417,712 bp[2]
Kraj30,419,854 bp[2]
Ontologija gena
Molekularna funkcija signaling receptor binding
GO:0001948 protein binding
phosphatidylinositol 3-kinase binding
Ćelijska komponenta integral component of membrane
cell surface
Ćelijska membrana
membrana
Biološki proces protein phosphorylation
regulation of immune response
positive regulation of phosphatidylinositol 3-kinase signaling
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_014266
NM_001007469

NM_011827

RefSeq (bjelančevina)

NP_001007470
NP_055081

NP_035957

Lokacija (UCSC)Chr 19: 35.9 – 35.9 MbChr 7: 30.42 – 30.42 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Pretvarač signala hematopoetskih ćelija ili tranduktor signala hematopoetskih signala je protein koji je dod ljudi kodiran genom HCST.[5][6]

Ovaj gen kodira transmembranski signalni adapter koji sadrži YxxM motiv u svojoj citoplazmatskom domenu. Kodirani protein može činiti dio kompleksa receptora imunskog prepoznavanja sa receptorom sličnim lektinu C tipa NKG2D. Kao dio ovog receptorskog kompleksa, ovaj protein može aktivirati signalne puteve ovisne o fosfatidilinozitol 3-kinazi, preko svog intracitoplazmatskog motiva YxxM.

Ovaj receptorski kompleks može imati ulogu u preživljavanju i proliferaciji ćelija, aktivacijom odgovora NK i T-ćelija. Alternativna prerada rezultira u dvije varijante transkripta, koji kodiraju različite izoforme.[6]

Aminokiselinska sekvenca[uredi | uredi izvor]

Simboli
1020304050
MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLL
AGLVAADAVASLLIVGAVFLCARPRRSPAQEDGKVYINMPGRG

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000126264 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000064109 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Wu J, Song Y, Bakker AB, Bauer S, Spies T, Lanier LL, Phillips JH (Aug 1999). "An activating immunoreceptor complex formed by NKG2D and DAP10". Science. 285 (5428): 730–2. doi:10.1126/science.285.5428.730. PMID 10426994.
  6. ^ a b "Entrez Gene: HCST hematopoietic cell signal transducer".

Dopunska literatura[uredi | uredi izvor]