Interleukin 8

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
CXCL8
IL8 Solution Structure.rsh.png
Dostupne strukture
PDBPretraga Human UniProta: PDBe RCSB
Spisak PDB ID kodova

3IL8, 1ICW, 1IKL, 1IKM, 1IL8, 1ILP, 1ILQ, 1QE6, 1ROD, 2IL8, 4XDX

Identifikatori
AliasiCXCL8
Vanjski ID-jeviOMIM: 146930 HomoloGene: 47937 GeneCards: CXCL8
Lokacija gena (čovjek)
Hromosom 4 (čovjek)
Hrom.Hromosom 4 (čovjek)[1]
Hromosom 4 (čovjek)
Genomska lokacija za CXCL8
Genomska lokacija za CXCL8
Bend4q13.3Početak73,740,519 bp[1]
Kraj73,743,716 bp[1]
Obrazac RNK ekspresije
PBB GE IL8 202859 x at.png

PBB GE IL8 211506 s at.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija cytokine activity
GO:0001948, GO:0016582 protein binding
interleukin-8 receptor binding
chemokine activity
Ćelijska komponenta extracellular region
intracellular anatomical structure
Vanćelijsko
Biološki proces G protein-coupled receptor signaling pathway
GO:0007243 intracellular signal transduction
chemokine-mediated signaling pathway
cellular response to tumor necrosis factor
receptor internalization
cellular response to fibroblast growth factor stimulus
response to endoplasmic reticulum stress
positive regulation of angiogenesis
regulation of single stranded viral RNA replication via double stranded DNA intermediate
PERK-mediated unfolded protein response
induction of positive chemotaxis
Hemotaksija
regulation of cell adhesion
GO:0046730, GO:0046737, GO:0046738, GO:0046736 Imuni odgovor
cellular response to interleukin-1
Angiogeneza
positive regulation of neutrophil chemotaxis
inflammatory response
negative regulation of G protein-coupled receptor signaling pathway
response to molecule of bacterial origin
cellular response to lipopolysaccharide
embryonic digestive tract development
GO:0072468 signal transduction
negative regulation of cell population proliferation
calcium-mediated signaling
regulation of entry of bacterium into host cell
defense response
neutrophil chemotaxis
neutrophil activation
antimicrobial humoral immune response mediated by antimicrobial peptide
regulation of signaling receptor activity
cytokine-mediated signaling pathway
leukocyte chemotaxis
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_000584
NM_001354840

n/a

RefSeq (bjelančevina)

NP_000575
NP_001341769

n/a

Lokacija (UCSC)Chr 4: 73.74 – 73.74 Mbn/a
PubMed pretraga[2]n/a
Wikipodaci
Pogledaj/uredi – čovjek

Hemokinski ligand 8 ili interleukin 8 (IL-8, C-X-C motiv) jest hemokin koji je kod ljudi kodiran genom CXCL8 sa hromosoma 4. Proizvode ga makrofagi i drugi tipovi ćelija kao što su epitelne ćelije, ćelije glatkih mišića disajnih puteva[3] i endotelne ćelije. Endotelne ćelije pohranjuju IL-8 u svoje skladišne vezikule, Weibel-Paladeova tijela.[4][5][6] IL-8 se u početku proizvodi kao prekursorski peptid od 99 aminokiselina koji se zatim cijepa kako bi se stvorilo nekoliko aktivnih izoformi IL-8.[7] U kulturi, peptid od 72 aminokiseline je glavni oblik koji luče makrofagi.

Postoji mnogo receptora na površinskoj membrani sposobnih da vežu IL-8; najčešće proučavani tipovi su G-protgein spregnuti serpentinski receptori CXCR1 i CXCR2. Ekspresija i afinitet za IL-8 razlikuju se između dva receptora (CXCR1 > CXCR2). U lancu biohemijskih reakcija, IL-8 se luči i važan je posrednik imunske reakcije u odgovoru urođenog imunskog sistema.

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 99 aminokiselina, а molekulska težina Da. 11 098[8]

table style="font-family:monospace;">

1020304050 MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIK ELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Funkcija[uredi | uredi izvor]

IL-8, također poznat kao "neutrofilni hemotaksijski faktor", ima dvije primarne funkcije. Inducira hemotaksije u ciljnim ćelijama, prvenstveno neutrofilima, ali i drugim granulocitima, uzrokujući da migriraju prema mjestu infekcije. IL-8 takođe stimulira fagocitozu kada stignu. IL-8 je također poznat kao moćan promotor angiogeneze. U ciljnim ćelijama, IL-8 inducira niz fizioloških odgovora potrebnih za migraciju i fagocitozu, kao što je povećanje razine unutarćelijskog Ca2+, egzocitoza (npr. oslobađanje histamina) i respiratorni prasak.

IL-8 mogu izlučiti bilo koje ćelije sa odgovafrajućim receptorima, koje su uključene u urođeni imunski odgovor i pokazalo se da je dobavljač hemokina za CR2 + nevine T-ćelije, poznate i kao nedavni timusni emigranti.[9] Obično su makrofagi prvi koji registrirji antigen, pa su prve ćelije koje oslobađaju IL-8, kako bi regrutirale druge ćelije. I monomerni i homodimerni oblici IL-8 su prijavljeni kao moćni induktori hemokinskih receptora CXCR1 i CXCR2. Homodimer je snažniji, ali metilacija Leu25 može blokirati aktivnost homodimera.

Vjeruje se da IL-8 ima ulogu u patogenezi bronhiolitisa, uobičajene bolesti respiratornog trakta uzrokovane virusnom infekcijom.

IL-8 je član hemokinske porodice CXC. Geni koji kodiraju ovaj i ostalih deset članova porodice hemokina CXC tvore klaster u regiji mapiranoj na dugom (q) kraku hromosoma 4.[6][10]

CXCL-8 posredovana hemotaksija neutrofila[uredi | uredi izvor]

CXCL8 je primarni citokin, uključen u regrutaciju neutrofila na mjesto oštećenja ili infekcije; u procesu koji se naziva hemotaksija. Brojne varijable su neophodne za uspješnu hemotaksiju neutrofila, uključujući povećanu ekspresiju adhezijskih molekula visokog afiniteta, kako bi se neutrofil pričvrstio za endotel u blizini zahvaćenog mjesta (i stoga se ne ispire u krvotok), te da neutrofil može proći put kroz baznu membranu i vanćelijski matriks (ECM), kako bi stigao do zahvaćenog mjesta. CXCL8 ima ključnu ulogu u izazivanju ćelijske signalizacije potrebne za donošenje ovih promjena.[11]

.

Prvo, na mjestu infekcije, oslobađanje histamina uzrokuje vazodilataciju kapilara u blizini ozlijeđenog područja, što usporava protok krvi u regiji i podstiče leukocite, kao što su neutrofili, da se približe endotelu i dalje od centar lumena, gde je brzina krvotoka najveća. Kada se to dogodi, stvaraju se slabe interakcije između selektina eksprimiranih na neutrofilnim i endotelnim ćelijama (čija ekspresija se također povećava djelovanjem CXCL8 i drugih citokina). Na neutrofilu su to: L selektini, a na endotelnoj ćeliji: P i E selektini. Ovo uzrokuje fazu hemotaksijskog "kotrljanja".

Kada se neutrofil kotrlja duž endotela, dolazi u kontakt s molekulom CXCL8, eksprimiranom na površini, koja stimulira ćelijski signalni put, posredovan preko G-protein spregnutog receptora. Vezivanje CXCL8 na CXCR1/2 na neutrofilu stimulira neutrofile da pojačaju svoju ekspresiju integrina, LFA-1, koji učestvuje u vezivanju visokog afiniteta sa receptorima ICAM-1 eksprimiranim na endotelu. Ekspresija i afinitet LFA-1 su značajno povećani kako bi se maksimiziralo vezivanje. Ovo uzrokuje da se neutrofil još više usporava dok se ne smiri.

Druga ključna funkcija ćelijske signalizacije stimulirane CXCL8-om je pokretanje oksidativnog naleta. Ovaj proces omogućava stvaranje proteolitskih enzima i reaktivnih vrsta kiseonika (ROS) koje su neophodne za razgradnju vanćelijskog matriksa i bazne membrane. Oslobađaju se u sekretornim granulama, zajedno s više integrina. Oslobađanje ROS-a i štetnih enzima regulirano je tako da bi se smanjilo oštećenje domaćina, ali nastavlja dopirati do mjesta infekcije na kojem će obavljati svoje efektorske funkcije.[11]

Ciljne ćelije[uredi | uredi izvor]

Dok su neutrofilni granulociti primarne ciljne ćelije IL-8, postoji relativno širok raspon ćelija (endotelne ćelije, makrofagi, mastociti i keratinociti) koji reaguju na ovaj hemokin. Hemoatraktantna aktivnost IL-8 u koncentracijama sličnim kičmenjačkim dokazana je u Tetrahymena pyriformis, što ukazuje na filogenetski dobro konzerviranu strukturu i funkciju ovog hemokina.[12]

Klinički značaj[uredi | uredi izvor]

Interleukin-8 je ključni medijator povezan s upalama, gdje ima ključnu ulogu u regrutaciji i degranulaciji neutrofila.[13] Kao primjer, naveden je kao proupalni medijator kod gingivitisa[14] i psorijaze.

Sekrecija interleukina-8 povećava se oksidativnim stresom, koji na taj način uzrokuje regrutaciju upalnih stanica i inducira daljnji porast medijatora oksidativnog stresa, što ga čini ključnim parametrom u lokaliziranoj upali.[15] Pokazalo se da je IL-8 povezan sa gojaznošću.[16]

Također se pretpostavlja da IL-8 ima ulogu u kolorekumskom karcinomu djelujući kao autokrini faktor rasta za ćelijskee linije karcinoma debelog crijeva[17] ili podstcanje podjele i moguće migracije cijepanjem molekula metaloproteinaza.[18] Također je pokazano da IL-8 ima važnu ulogu u hemorezistenciji malignog pleurnog mezotelioma, indukcijom ekspresije transmembranskih transportera.[19]

Ako trudna majka ima visok nivo interleukina-8, postoji povećan rizik od shizofrenije kod njenog potomstva.[20] Pokazalo se da visoki nivoi interleukina 8 smanjuju vjerovatnoću pozitivnih odgovora na antipsihotične lijekove kod shizofrenije.[21]

IL-8 je također uključen u patološke promjene kod cistaste fibroze. Svojim djelovanjem kao signalne molekule IL-8 je sposoban da regrutuje i vodi neutrofile do plućnog epitela. Prekomjerna stimulacija i disfunkcija ovih regrutovanih neutrofila unutar dišnih puteva rezultira oslobađanjem niza proupalnih molekula i proteaza, što rezultira daljnjim oštećenjem plućnog tkiva.[22]

Neki benzodiazepini imaju inhibitorne efekte na adenozin A2B receptorski posredovano lučenje interleukina-8 u ljudskim mastocitima. U studiji iz 2013. godine, diazepam, 4'-lhorodiazepam i flunitrazepam značajno su smanjili NECA-indukovanu proizvodnju interleukina-8 tim redoslijedom snage, dok je hlonazepam pokazao samo umjerenu inhibiciju.[23]

Regulacija ekspresije[uredi | uredi izvor]

Ekspresija IL-8 negativno je regulirana brojnim mehanizmima. MiRNA-146a / b-5p indirektno potiskuje ekspresiju IL-8 utišavanjem ekspresije IRAK1.[24] Dodatno, 3' UTR IL-8 sadrži element bogat A/U, što ga čini izuzetno nestabilnim pod određenim uvjetima. IL-8 i drugi upalni citokini formiraju začarani krug sa faktorom transkripcije NF-κB u cistastoj fibrozi.[25] Regulacija NF-κB predstavlja novu anti-IL-8 terapiju za upotrebu kod upalnih bolesti, kao što je cistasta fibroza. Putevi koji dovode do indukcije fosforilacije ribosomnog proteina S6 (rpS6) također su utvrđeno da pojačavaju sintezu proteina IL-8. Ova translacijska kontrola ekspresije IL-8 zavisi od A/U-bogatih proksimalnih sekvenci (APS), koje se nalaze u 3'UTR IL-8, odmah nakon stop kodona.[26]

Nomenklatura[uredi | uredi izvor]

Potkomitet za nomoklaturu hemokina Međunarodne unije imunoloških društava, IL-8 preimenovao je u CXCL8.[27] Njegov odobreni genski simbol Organizacije za ljudski genom je CXCL8. Njegovi receptori su na sličan način preimenovani u:

  • Interleukin 8 receptor, alfa - CXCR1
  • Interleukin 8 receptor, beta - CXCR2

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000169429 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ Hedges JC, Singer CA, Gerthoffer WT (2000). "Mitogen-activated protein kinases regulate cytokine gene expression in human airway myocytes". Am. J. Respir. Cell Mol. Biol. 23 (1): 86–94. CiteSeerX 10.1.1.326.6212. doi:10.1165/ajrcmb.23.1.4014. PMID 10873157.
  4. ^ Wolff B, Burns AR, Middleton J, Rot A (1998). "Endothelial cell "memory" of inflammatory stimulation: human venular endothelial cells store interleukin 8 in Weibel-Palade bodies". J. Exp. Med. 188 (9): 1757–62. doi:10.1084/jem.188.9.1757. PMC 2212526. PMID 9802987.
  5. ^ Utgaard JO, Jahnsen FL, Bakka A, Brandtzaeg P, Haraldsen G (1998). "Rapid secretion of prestored interleukin 8 from Weibel-Palade bodies of microvascular endothelial cells". J. Exp. Med. 188 (9): 1751–6. doi:10.1084/jem.188.9.1751. PMC 2212514. PMID 9802986.
  6. ^ a b Modi WS, Dean M, Seuanez HN, Mukaida N, Matsushima K, O'Brien SJ (1990). "Monocyte-derived neutrophil chemotactic factor (MDNCF/IL-8) resides in a gene cluster along with several other members of the platelet factor 4 gene superfamily". Hum. Genet. 84 (2): 185–7. doi:10.1007/BF00208938. PMID 1967588. S2CID 2217894.
  7. ^ Brat DJ, Bellail AC, Van Meir EG (2005). "The role of interleukin-8 and its receptors in gliomagenesis and tumoral angiogenesis". Neuro-Oncology. 7 (2): 122–133. doi:10.1215/s1152851704001061. PMC 1871893. PMID 15831231.
  8. ^ "UniProt, P10145" (jezik: engleski). Pristupljeno 23. 10. 2021.
  9. ^ Pekalski ML, García AR, Ferreira RC, Rainbow DB, Smyth DJ, Mashar M, Brady J, Savinykh N, Dopico XC, Mahmood S, Duley S, Stevens HE, Walker NM, Cutler AJ, Waldron-Lynch F, Dunger DB, Shannon-Lowe C, Coles AJ, Jones JL, Wallace C, Todd JA, Wicker LS (august 2017). "Neonatal and adult recent thymic emigrants produce IL-8 and express complement receptors CR1 and CR2". JCI Insight. 2 (16). doi:10.1172/jci.insight.93739. PMC 5621870. PMID 28814669.
  10. ^ "Entrez Gene: IL8 interleukin 8".
  11. ^ a b Dixit N, Simon SI (2012). "Chemokines, selectins and intracellular calcium flux: temporal and spatial cues for leukocyte arrest". Frontiers in Immunology. 3: 188. doi:10.3389/fimmu.2012.00188. PMC 3392659. PMID 22787461.
  12. ^ Köhidai L, Csaba G (1998). "Chemotaxis and chemotactic selection induced with cytokines (IL-8, RANTES and TNF-alpha) in the unicellular Tetrahymena pyriformis". Cytokine. 10 (7): 481–6. doi:10.1006/cyto.1997.0328. PMID 9702410. S2CID 33755476.
  13. ^ Harada A, Sekido N, Akahoshi T, Wada T, Mukaida N, Matsushima K (Nov 1994). "Essential involvement of interleukin-8 (IL-8) in acute inflammation". Journal of Leukocyte Biology. 56 (5): 559–64. doi:10.1002/jlb.56.5.559. PMID 7964163. S2CID 8035653. Arhivirano s originala, 27. 7. 2016.
  14. ^ Haake, SK, Huang, GTJ: Molecular Biology of the host-Microbe Interaction in Periodontal Diseases (Selected Topics). In Newman, Takei, Carranza, editors: Clinical Periodontology, 9th Edition. Philadelphia: W.B.Saunders Co. 2002. page 162.
  15. ^ Vlahopoulos S, Boldogh I, Casola A, Brasier AR (1999). "Nuclear factor-kappaB-dependent induction of interleukin-8 gene expression by tumor necrosis factor alpha: evidence for an antioxidant sensitive activating pathway distinct from nuclear translocation". Blood. 94 (6): 1878–89. doi:10.1182/blood.V94.6.1878.418k03_1878_1889. PMID 10477716.
  16. ^ Sharabiani MT, Vermeulen R, Scoccianti C, Hosnijeh FS, Minelli L, Sacerdote C, Palli D, Krogh V, Tumino R, Chiodini P, Panico S, Vineis P (2011). "Immunologic profile of excessive body weight". Biomarkers. 16 (3): 243–51. doi:10.3109/1354750X.2010.547948. PMID 21506696. S2CID 36127785.
  17. ^ Brew R, Erikson JS, West DC, Kinsella AR, Slavin J, Christmas SE (2000). "Interleukin-8 as an autocrine growth factor for human colon carcinoma cells in vitro". Cytokine. 12 (1): 78–85. doi:10.1006/cyto.1999.0518. PMID 10623446.
  18. ^ Itoh Y, Joh T, Tanida S, Sasaki M, Kataoka H, Itoh K, Oshima T, Ogasawara N, Togawa S, Wada T, Kubota H, Mori Y, Ohara H, Nomura T, Higashiyama S, Itoh M (2005). "IL-8 promotes cell proliferation and migration through metalloproteinase-cleavage proHB-EGF in human colon carcinoma cells". Cytokine. 29 (6): 275–82. doi:10.1016/j.cyto.2004.11.005. PMID 15749028.
  19. ^ Milosevic, V. et al. Wnt/IL-1β/IL-8 autocrine circuitries control chemoresistance in mesothelioma initiating cells by inducing ABCB5.Int. J. Cancer, https://doi.org/10.1002/ijc.32419
  20. ^ Brown AS, Hooton J, Schaefer CA, Zhang H, Petkova E, Babulas V, Perrin M, Gorman JM, Susser ES (2004). "Elevated maternal interleukin-8 levels and risk of schizophrenia in adult offspring". Am J Psychiatry. 161 (5): 889–95. doi:10.1176/appi.ajp.161.5.889. PMID 15121655.
  21. ^ Zhang XY, Zhou DF, Cao LY, Zhang PY, Wu GY, Shen YC (2004). "Changes in serum interleukin-2, -6, and -8 levels before and during treatment with risperidone and haloperidol: relationship to outcome in schizophrenia". J Clin Psychiatry. 65 (7): 940–7. doi:10.4088/JCP.v65n0710. PMID 15291683.
  22. ^ Reeves EP, Williamson M, O'Neill SJ, Greally P, McElvaney NG (Jun 2011). "Nebulized hypertonic saline decreases IL-8 in sputum of patients with cystic fibrosis". American Journal of Respiratory and Critical Care Medicine. 183 (11): 1517–23. doi:10.1164/rccm.201101-0072oc. PMID 21330456.
  23. ^ Hoffmann K, Xifró RA, Hartweg JL, Spitzlei P, Meis K, Molderings GJ, von Kügelgen I (Jan 2013). "Inhibitory effects of benzodiazepines on the adenosine A(2B) receptor mediated secretion of interleukin-8 in human mast cells". Eur J Pharmacol. 700 (1–3): 152–8. doi:10.1016/j.ejphar.2012.12.003. PMID 23266380.
  24. ^ Bhaumik D, Scott GK, Schokrpur S, Patil CK, Orjalo AV, Rodier F, Lithgow GJ, Campisi J (2009). "MicroRNAs miR-146a/b negatively modulate the senescence-associated inflammatory mediators IL-6 and IL-8". Aging. 1 (4): 402–11. doi:10.18632/aging.100042. PMC 2818025. PMID 20148189.
  25. ^ Rottner M, Freyssinet JM, Martínez MC (2009). "Mechanisms of the noxious inflammatory cycle in cystic fibrosis". Respir. Res. 10 (1): 23. doi:10.1186/1465-9921-10-23. PMC 2660284. PMID 19284656.
  26. ^ Ang Z, Abdi Gunawan Koen R, Er JZ, Lee LT, Tam Kit Chung J, Guo H, Ding JL (2019). "Novel AU-rich proximal UTR sequences (APS) enhance CXCL8 synthesis upon the induction of rpS6 phosphorylation". PLOS Genet. 15 (4): e1008077. doi:10.1371/journal.pgen.1008077. PMC 6476525. PMID 30969964.
  27. ^ Bacon K, Baggiolini M, Broxmeyer H, Horuk R, Lindley I, Mantovani A, Maysushima K, Murphy P, Nomiyama H, Oppenheim J, Rot A, Schall T, Tsang M, Thorpe R, Van Damme J, Wadhwa M, Yoshie O, Zlotnik A, Zoon K (2002). "Chemokine/chemokine receptor nomenclature". J. Interferon Cytokine Res. 22 (10): 1067–8. doi:10.1089/107999002760624305. PMID 12433287.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]