LYPD5

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
LYPD5
Identifikatori
AliasiLYPD5
Vanjski ID-jeviMGI: 1924192 HomoloGene: 18797 GeneCards: LYPD5
Lokacija gena (čovjek)
Hromosom 19 (čovjek)
Hrom.Hromosom 19 (čovjek)[1]
Hromosom 19 (čovjek)
Genomska lokacija za LYPD5
Genomska lokacija za LYPD5
Bend19q13.31Početak43,785,874 bp[1]
Kraj43,827,206 bp[1]
Ontologija gena
Molekularna funkcija laminin binding
Ćelijska komponenta membrana
anchored component of membrane
extracellular region
Ćelijska membrana
Biološki proces cell-matrix adhesion
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001031749
NM_001288763
NM_182573

NM_029806

RefSeq (bjelančevina)

NP_001026919
NP_001275692
NP_872379

NP_084082

Lokacija (UCSC)Chr 19: 43.79 – 43.83 Mbn/a
PubMed pretraga[2][3]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

LY6/PLAUR domen sadržavajući protein 5 je protein koji je kod ljudi kodiran genom LYPD5.[4]

Aminokiselinski sastav[uredi | uredi izvor]

Simboli
1020304050
MAMGVPRVILLCLFGAALCLTGSQALQCYSFEHTYFGPFDLRAMKLPSIS
CPHECFEAILSLDTGYRAPVTLVRKGCWTGPPAGQTQSNADALPPDYSVV
RGCTTDKCNAHLMTHDALPNLSQAPDPPTLSGAECYACIGVHQDDCAIGR
SRRVQCHQDQTACFQGNGRMTVGNFSVPVYIRTCHRPSCTTEGTTSPWTA
IDLQGSCCEGYLCNRKSMTQPFTSASATTPPRALQVLALLLPVLLLVGLS
A

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000159871 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Entrez Gene: LY6/PLAUR domain containing 5". Pristupljeno 5. 4. 2016.

Dopunska literatura[uredi | uredi izvor]