Idi na sadržaj

MAPKAPK2

S Wikipedije, slobodne enciklopedije
MAPKAPK2
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1KWP, 1NXK, 1NY3, 2JBO, 2JBP, 2OKR, 2ONL, 2OZA, 2P3G, 2PZY, 3A2C, 3FPM, 3FYJ, 3FYK, 3GOK, 3KA0, 3KC3, 3KGA, 3M2W, 3M42, 3R2B, 3R2Y, 3R30, 3WI6, 4TYH

Identifikatori
AliasiMAPKAPK2
Vanjski ID-jeviOMIM: 602006 MGI: 109298 HomoloGene: 56412 GeneCards: MAPKAPK2
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za MAPKAPK2
Genomska lokacija za MAPKAPK2
Bend1q32.1Početak206,684,905 bp[1]
Kraj206,734,281 bp[1]
Lokacija gena (miš)
Hromosom 1 (miš)
Hrom.Hromosom 1 (miš)[2]
Hromosom 1 (miš)
Genomska lokacija za MAPKAPK2
Genomska lokacija za MAPKAPK2
Bend1|1 E4Početak130,981,437 bp[2]
Kraj131,025,563 bp[2]
Obrazac RNK ekspresije




Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija calmodulin-dependent protein kinase activity
signal transducer activity
nucleotide binding
aktivnost sa transferazom
kinase activity
calcium-dependent protein serine/threonine kinase activity
calmodulin binding
ATP binding
GO:0001948, GO:0016582 vezivanje za proteine
protein kinase activity
protein serine/threonine kinase activity
mitogen-activated protein kinase binding
Ćelijska komponenta Egzosom
citosol
centrosom
nukleoplazma
citoplazma
jedro
Biološki proces response to stress
MAPK cascade
regulation of mRNA stability
response to cytokine
GO:0035404 peptidyl-serine phosphorylation
cellular response to vascular endothelial growth factor stimulus
mRNA stabilization
protein autophosphorylation
3'-UTR-mediated mRNA stabilization
cellular response to DNA damage stimulus
inner ear development
p38MAPK cascade
Ras protein signal transduction
leukotriene metabolic process
regulation of cellular response to heat
Fosforilacija
protein phosphorylation
regulation of interleukin-6 production
vascular endothelial growth factor receptor signaling pathway
response to lipopolysaccharide
inflammatory response
macropinocytosis
regulation of tumor necrosis factor production
toll-like receptor signaling pathway
GO:0007243 intracellular signal transduction
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_004759
NM_032960

NM_008551

RefSeq (bjelančevina)

NP_004750
NP_116584

NP_032577

Lokacija (UCSC)Chr 1: 206.68 – 206.73 MbChr 1: 130.98 – 131.03 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

MAP kinaza-aktivirana protein-kinazom 2 jest enzim koji je kod ljudi kodiran genom MAPKAPK2 sa hromosoma 1[5][6][7]

Aminokiselinska sekvenca

[uredi | uredi izvor]

Dužina polipeptidnog lanca je 400 aminokiselina, a molekulska težina 45.568 Da.[8]

1020304050
MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKS
GLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPK
ARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRI
QDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPN
AILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLG
VIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKM
LIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWE
DVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH

Funkcija

[uredi | uredi izvor]

Ovaj gen kodira člana porodice Ser/Thr protein kinaze. Ova kinaza regulirana je direktnom fosforilacijom, pomoću p38 MAP-kinaza. Poznato je da je, zajedno sa p38 MAP-kinazom, ova kinaza uključena u mnoge ćelijske procese, kao što su stres i upalne odgovore, jedarni eksport, regulaciju ekspresije gena i proliferaciju ćelija. Pokazalo se da je protein toplotnog šoka HSP27 njegov glavni direktni supstrat in vivo. Za ovaj gen su pronađene dvije varijante transkripta koje kodiraju dvije različite izoforme.[9]

Vaskularna barijera

[uredi | uredi izvor]

Pokazalo se da put MK2 ima ključnu ulogu u održavanju i popravljanju integriteta endotelne barijere u plućima putem aktina [10] i remodeliranja vimentina. Pokazalo se da aktivacija MK2 putem njegove fosforilacije pomoću p38 obnavlja vaskularnu barijeru[7] i popravlja vaskularno curenje,[11] povezano sa preko 60 medicinskih stanja, uključujući sindrom akutnog respiratornog distresa (ARDS), glavnog uzroka smrti širom svijeta.[12]

Inicijacija SASP-a

[uredi | uredi izvor]

MAPKAPK2 posreduje u inicijaciji sekretornog fenotipa vezanog za starenje (SASP), pomoću mTOR (mehanička meta rapamicina).[13][14] Interleukin 1 alfa (IL1A) nalazi se na površini senescentnih ćelija, gdje doprinosi proizvodnji SASP faktora zbog pozitivne povratne petlje sa NF-κB.[15][16] Translacija iRNK za IL1A u velikoj mjeri ovisi o aktivnosti mTOR-a.[17] Aktivnost mTOR povećava nivoe IL1A, posredovane putem MAPKAPK2.[15]

Također pogledajte

[uredi | uredi izvor]

Interakcije

[uredi | uredi izvor]

Pokazalo se da MAPKAPK2 ima interakcije sa:

Reference

[uredi | uredi izvor]
  1. 1 2 3 GRCh38: Ensembl release 89: ENSG00000162889 - Ensembl, maj 2017
  2. 1 2 3 GRCm38: Ensembl release 89: ENSMUSG00000016528 - Ensembl, maj 2017
  3. "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. Zu YL, Wu F, Gilchrist A, Ai Y, Labadia ME, Huang CK (april 1994). "The primary structure of a human MAP kinase activated protein kinase 2". Biochemical and Biophysical Research Communications. 200 (2): 1118–24. doi:10.1006/bbrc.1994.1566. PMID 8179591.
  6. Stokoe D, Caudwell B, Cohen PT, Cohen P (decembar 1993). "The substrate specificity and structure of mitogen-activated protein (MAP) kinase-activated protein kinase-2". The Biochemical Journal. 296 ( Pt 3) (Pt 3): 843–9. doi:10.1042/bj2960843. PMC 1137771. PMID 8280084.
  7. 1 2 Liu T, Warburton RR, Hill NS, Kayyali US (august 2015). "Anthrax lethal toxin-induced lung injury and treatment by activating MK2". Journal of Applied Physiology. 119 (4): 412–9. doi:10.1152/japplphysiol.00335.2015. PMC 4538279. PMID 26066827.
  8. "UniProt, P49137" (jezik: engleski). Pristupljeno 13. 12. 2021.
  9. "Entrez Gene: MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2".
  10. Sousa AM, Liu T, Guevara O, Stevens J, Fanburg BL, Gaestel M, et al. (april 2007). "Smooth muscle alpha-actin expression and myofibroblast differentiation by TGFbeta are dependent upon MK2". Journal of Cellular Biochemistry. 100 (6): 1581–92. doi:10.1002/jcb.21154. PMC 2586991. PMID 17163490.
  11. Liu T, Milia E, Warburton RR, Hill NS, Gaestel M, Kayyali US (april 2012). "Anthrax lethal toxin disrupts the endothelial permeability barrier through blocking p38 signaling". Journal of Cellular Physiology. 227 (4): 1438–45. doi:10.1002/jcp.22859. PMC 4254851. PMID 21618534.
  12. Pham T, Rubenfeld GD (april 2017). "Fifty Years of Research in ARDS. The Epidemiology of Acute Respiratory Distress Syndrome. A 50th Birthday Review". American Journal of Respiratory and Critical Care Medicine. 195 (7): 860–870. doi:10.1164/rccm.201609-1773CP. PMID 28157386. S2CID 23293950.
  13. Yessenkyzy A, Saliev T, Zhanaliyeva M, Masoud AR, Umbayev B, Sergazy S, et al. (maj 2020). "Polyphenols as Caloric-Restriction Mimetics and Autophagy Inducers in Aging Research". Nutrients. 12 (5): 1344. doi:10.3390/nu12051344. PMC 7285205. PMID 32397145.
  14. Papadopoli D, Boulay K, Kazak L, Pollak M, Mallette F, Topisirovic I, Hulea L (2019). "mTOR as a central regulator of lifespan and aging". F1000Research. 8: 998. doi:10.12688/f1000research.17196.1. PMC 6611156. PMID 31316753.
  15. 1 2 Laberge RM, Sun Y, Orjalo AV, Patil CK, Freund A, Zhou L, et al. (august 2015). "MTOR regulates the pro-tumorigenic senescence-associated secretory phenotype by promoting IL1A translation". Nature Cell Biology. 17 (8): 1049–61. doi:10.1038/ncb3195. PMC 4691706. PMID 26147250.
  16. Wang R, Yu Z, Sunchu B, Shoaf J, Dang I, Zhao S, et al. (juni 2017). "Rapamycin inhibits the secretory phenotype of senescent cells by a Nrf2-independent mechanism". Aging Cell. 16 (3): 564–574. doi:10.1111/acel.12587. PMC 5418203. PMID 28371119.
  17. Wang R, Sunchu B, Perez VI (august 2017). "Rapamycin and the inhibition of the secretory phenotype". Experimental Gerontology. 94: 89–92. doi:10.1016/j.exger.2017.01.026. PMID 28167236. S2CID 4960885.
  18. 1 2 Rane MJ, Coxon PY, Powell DW, Webster R, Klein JB, Pierce W, et al. (februar 2001). "p38 Kinase-dependent MAPKAPK-2 activation functions as 3-phosphoinositide-dependent kinase-2 for Akt in human neutrophils". The Journal of Biological Chemistry. 276 (5): 3517–23. doi:10.1074/jbc.M005953200. PMID 11042204.
  19. Janknecht R (novembar 2001). "Cell type-specific inhibition of the ETS transcription factor ER81 by mitogen-activated protein kinase-activated protein kinase 2". The Journal of Biological Chemistry. 276 (45): 41856–61. doi:10.1074/jbc.M106630200. PMID 11551945.
  20. 1 2 Yannoni YM, Gaestel M, Lin LL (april 2004). "P66(ShcA) interacts with MAPKAP kinase 2 and regulates its activity". FEBS Letters. 564 (1–2): 205–11. doi:10.1016/S0014-5793(04)00351-5. PMID 15094067.
  21. Dondelinger Y, Delanghe T, Rojas-Rivera D, Priem D, Delvaeye T, Bruggeman I, et al. (oktobar 2017). "MK2 phosphorylation of RIPK1 regulates TNF-mediated cell death". Nature Cell Biology. 19 (10): 1237–1247. doi:10.1038/ncb3608. PMID 28920952. S2CID 25779284.

Dopunska literatura

[uredi | uredi izvor]

Vanjski linkovi

[uredi | uredi izvor]