Idi na sadržaj

MMP11

S Wikipedije, slobodne enciklopedije
MMP11
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1HV5

Identifikatori
AliasiMMP11
Vanjski ID-jeviOMIM: 185261 MGI: 97008 HomoloGene: 38116 GeneCards: MMP11
Lokacija gena (miš)
Hromosom 10 (miš)
Hrom.Hromosom 10 (miš)[1]
Hromosom 10 (miš)
Genomska lokacija za MMP11
Genomska lokacija za MMP11
Bend10 C1|10 38.62 cMPočetak75,759,056 bp[1]
Kraj75,772,330 bp[1]
Obrazac RNK ekspresije


Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija vezivanje iona cinka
GO:0070122 peptidase activity
metalloendopeptidase activity
hydrolase activity
metallopeptidase activity
vezivanje iona metala
serine-type endopeptidase activity
Ćelijska komponenta Golgi lumen
extracellular region
GO:0005578 Vanćelijski matriks
Vanćelijsko
Biološki proces collagen catabolic process
multicellular organism development
negative regulation of fat cell differentiation
extracellular matrix disassembly
Proteoliza
collagen fibril organization
basement membrane organization
extracellular matrix organization
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_005940

NM_008606
NM_001306184

RefSeq (bjelančevina)

NP_005931
NP_005931.2

NP_001293113
NP_032632

Lokacija (UCSC)n/aChr 10: 75.76 – 75.77 Mb
PubMed pretraga[2][3]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Stromelizin-3 (SL-3), znan i kao matriksna metaloproteinaza-11 (MMP-11) jest enzim koji je kod ljudi kodiran genom MMP11 sa hromosoma 22.[4][5][6][7]

Aminokiselinska sekvenca

[uredi | uredi izvor]

Dužina polipeptidnog lanca je 488 aminokiselina, a molekulska težina 54.590 Da.[7]

1020304050
MAPAAWLRSAAARALLPPMLLLLLQPPPLLARALPPDAHHLHAERRGPQP
WHAALPSSPAPAPATQEAPRPASSLRPPRCGVPDPSDGLSARNRQKRFVL
SGGRWEKTDLTYRILRFPWQLVQEQVRQTMAEALKVWSDVTPLTFTEVHE
GRADIMIDFARYWHGDDLPFDGPGGILAHAFFPKTHREGDVHFDYDETWT
IGDDQGTDLLQVAAHEFGHVLGLQHTTAAKALMSAFYTFRYPLSLSPDDC
RGVQHLYGQPWPTVTSRTPALGPQAGIDTNEIAPLEPDAPPDACEASFDA
VSTIRGELFFFKAGFVWRLRGGQLQPGYPALASRHWQGLPSPVDAAFEDA
QGHIWFFQGAQYWVYDGEKPVLGPAPLTELGLVRFPVHAALVWGPEKNKI
YFFRGRDYWRFHPSTRRVDSPVPRRATDWRGVPSEIDAAFQDADGYAYFL
RGRLYWKFDPVKVKALEGFPRLVGPDFFGCAEPANTFL

Funkcija

[uredi | uredi izvor]

Proteini iz porodice matriksnih metaloproteinaza (MMP) uključeni su u razgradnju vanćelijskog matriksa u normalnim fiziološkim procesima, kao što su embrionski razvoj, reprodukcija i remodeliranje tkiva, kao i u procesima bolesti , kao što su artritis i metastaze. Većina MMP izlučuje se kao neaktivni proprotein koji se aktiviraju kada ih cijepaju vanćelijske proteinaze. Međutim, enzim koji je kodiran ovim genom aktivira se unutarćelijski pomoću furina unutar konstitutivnog sekretornog puta. Također, za razliku od drugih MMP, ovaj enzim cijepa alfa inhibitor 1-proteinaza, ali slabo razgrađuje strukturne proteine vanćelijskog matriksa.[7]

Reference

[uredi | uredi izvor]
  1. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000000901 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ Levy A, Zucman J, Delattre O, Mattei MG, Rio MC, Basset P (Aug 1992). "Assignment of the human stromelysin 3 (STMY3) gene to the q11.2 region of chromosome 22". Genomics. 13 (3): 881–3. doi:10.1016/0888-7543(92)90175-R. PMID 1639418.
  5. ^ Anglard P, Melot T, Guerin E, Thomas G, Basset P (Oct 1995). "Structure and promoter characterization of the human stromelysin-3 gene". J Biol Chem. 270 (35): 20337–44. doi:10.1074/jbc.270.35.20337. PMID 7657606.
  6. ^ Luo D, Mari B, Stoll I, Anglard P (Jul 2002). "Alternative splicing and promoter usage generates an intracellular stromelysin 3 isoform directly translated as an active matrix metalloproteinase". J Biol Chem. 277 (28): 25527–36. doi:10.1074/jbc.M202494200. PMID 12006591.
  7. ^ a b c "Entrez Gene: MMP11 matrix metallopeptidase 11 (stromelysin 3)".

Dopunska literatura

[uredi | uredi izvor]

Vanjski linkovi

[uredi | uredi izvor]