MSI2

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
MSI2
Musashi2 protein in homolog 2 in Homo sapiens.png
Identifikatori
AliasiMSI2
Vanjski ID-jeviOMIM: 607897 MGI: 1923876 HomoloGene: 62199 GeneCards: MSI2
Lokacija gena (čovjek)
Hromosom 17 (čovjek)
Hrom.Hromosom 17 (čovjek)[1]
Hromosom 17 (čovjek)
Genomska lokacija za MSI2
Genomska lokacija za MSI2
Bend17q22Početak57,255,851 bp[1]
Kraj57,684,689 bp[1]
Lokacija gena (miš)
Hromosom 11 (miš)
Hrom.Hromosom 11 (miš)[2]
Hromosom 11 (miš)
Genomska lokacija za MSI2
Genomska lokacija za MSI2
Bend11|11 CPočetak88,339,382 bp[2]
Kraj88,718,513 bp[2]
Ontologija gena
Molekularna funkcija GO:0001948 protein binding
single-stranded RNA binding
nucleic acid binding
poly(U) RNA binding
RNA binding
Ćelijska komponenta citoplazma
polysome
Ribonukleoprotein
Biološki proces stem cell development
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_138962
NM_170721
NM_001322250
NM_001322251

NM_001201341
NM_054043
NM_001363194
NM_001363195
NM_001373923

RefSeq (bjelančevina)

NP_001309179
NP_001309180
NP_620412
NP_733839

NP_001188270
NP_473384
NP_001350123
NP_001350124
NP_001360852

Lokacija (UCSC)Chr 17: 57.26 – 57.68 MbChr 11: 88.34 – 88.72 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Protein Musashi-2, poznat i kao Musashi RNK-vezujući protein 2, je protein koji je kod ljudi kodiran genpm MSI2.[5] Kao i njegov homolog musashi-1 (MSI1), i on je RNK-vezujući protein uključen u matičnost.

Dužina polipeptidnog lanca je 328 aminokiselina, sa molekulskom težinom od 35.197[6].

Aminokiselinska sekvenca

Simboli
1020304050
MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIREC
MVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRR
AQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRH
RGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRA
RGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAYG
PVAAAAVAAARGSGSNPARPGGFPGANSPGPVADLYGPASQDSGVGNYIS
AASPQPGSGFGHGIAGPLIATAFTNGYH

Ekspresija[uredi | uredi izvor]

Postoje dva homolpgna gena koja se nalaze kod sisara, a nazivaju se musashi1 (MSI1) i musashi-2 (MSI2). Musashi-2 je RNK-vezujući protein, eksprimiran u neuronskim progenitornim ćelijama, uključujući matične ćelije, i u normalnim i leukemijskim krvnim ćelijama.[7][8]

Musashi-2 također se eksprimira i u matičnim ćelijama i u širokom spektru tkiva, uključujući izbočeno područje folikula dlake, nezrele β-ćelije gušterače i neuronske progenitorne ćelije. MSI2 se eksprimiraa u ranim fazama razvoja, u komorskojnoj i subkomorskoj zoni,[9] u ćelijama loze astrocita. Tamo je prvi put otkriven. U sistemu hematopoeze, MSI2 je izrazito eksprimiran u najprimitivnijim prajmerima,[7][10] u odjeljcima matičnih ćelija, a njegova prekomjerna ekspresija pronađena je u ćelijskim linijama mijeloidne leukemije. U linijama neuronskih ćelija, protein MSI2, kao i njegov homolog MSI1, nalazi se isključivo u citoplazmi.

Kod ljudi se gen MSI2 nalazi u hromosomu 17, sekvenca 17q23.2.[11] i ima dužinu sekvence od 1.414 bp, kodirajući 987 bp.[12] Kod miša, MSI2 nalazi se na poziciji 11qB5-C,[9] a BC169841 u afričke kandžaste žabe (Xenopus laevis). Postoje dvije različite izoforme MSI2, eksprimirane u embrionskim matičnim ćelijama, izoforma 1 i izoforma 2, koje nastaju alternativnom preradom. Prva je veća kanonska izoforma, a druga je kraća, prerađena izoformna varijanta.

Funkcija[uredi | uredi izvor]

Ovaj gen kodira RNK-vezujući protein koji je član porodice Musashijevih proteina. Kodirani protein je translacijski regulator koji cilja gene uključene u tok i regulaciju ćelijskog ciklusa. Mutacije ovog gena povezane su sa lošom prognozom kod određenih vrsta karcinoma. Pokazalo se da je ovaj gen preuređen u određenim ćelijama karcinoma. Prvi gen musashi (skraćenica MSI) prvi je put otkriven u Drosophila, a zatim je kasnije identificiran u drugim eukariotskim vrstama. Uključen je u razvoj orgaizma.[13] Kao i kod ostalih proteina iz porodice Musashi koji vežu RNK, MSI2 je povezan sa matičnim ćelija+ama tkiva i utiče na asimetričnu ćelijsku diobu, funkciju klicnih ćelija, somatskih matičnih ćelija i određivanje sudbine ćelija u različitim tkivima.[8]

Kao protein koji veže RNK, MSI2 djeluje kao translacijski inhibitor.[10] Putem ovog molekulskog mehanizma, MSI2 doprinosi u više od jednog vitalnog aspekta, kao u razvoju živčanog sistema, regulaciji odjeljka hematopoetskih matičnih ćelija (HSC) ili samoobnavljanja i pluripotencije embrionskih matičnih ćelija. MSI2 učestvuje u velikom broju puteva povezanih sa samoobnavljanjem nekih matičnih ćelija. Međutim, nije fokusiran samo na jedan određeni tip. Ovisno o tkivu u kojem se nalazi, razvija različite funkcije.

Klinički značaj[uredi | uredi izvor]

Budući da je Musashi-2 uključen u stvaranje krvotvornih ćelija, povezan je i s patologijama karcinoma:

Mijeloidna leukemija[uredi | uredi izvor]

Utvrđeno je da MSI2 ima važnu ulogu u mijeloidnoj leukemiji. I kod hronične mijelogene leukemije (CML) i akutne mijeloidne leukemije (AML), MSI2 regulira proliferaciju matičnih ćelija hematopoeze i ne dozvoljava diferencijaciju ekspresije gena.[8]

Hronična mijelogena leukemija[uredi | uredi izvor]

Hronična mijelogena leukemija (CML) napreduje od početne faze, gdje se akumuliraju diferencirane mijeloidne ćelije, do ubrzane faze, u kojoj se ekspanzija ovih ćelija povećava i završava fazom blast krize. Utvrđeno je da MSI2, sa BCR-ABL genom, sudjeluje u stimulaciji napredovanja u agresivnu fazu.[8] Prvi dokaz koji pokazuje njegovu ulogu u ovoj fazi je visoka koncentracija u usporedbi s prvom fazom bolesti. Jedna od funkcija MSI2 je reguliranje ekspresije gena NUMB, uzrokujući njegovu inhibiciju.[14] Zato se funkcija MSI2 u ovoj bolesti proučava zajedno s ekspresijom Numb-a. Međutim, dok je Numb prekomjerno izražen tijekom hronične faze i smanjuje se u eksploziji, Musashi počinje prekomjernu ekspresiju u posljednjoj fatalnoj fazi HML-a.[15] Visoka ekspresija MSI2 prekida diferencijaciju i omogućava širenje nezrelih leukemijskih ćelija uzrokujući napredak u smrtonosnu fazu.

Akutna mijeloidna leukemija[uredi | uredi izvor]

Kako akutna mijeloidna leukemija (AML) ima slično ponašanje kao agresivna faza CML-a, uloga MSI2 i tamo je slična. Utvrđeno je da je MSI2 prekomjerno eksprimiran i u ovom tipu leukemije i da je njegova aktivnost povezana s Numb-om. Štaviše, visoka ekspresija MSI2 povezana je sa lošim kliničkim ishodom. Da bi se to dokazalo, pokazano je da nokaut-gen MSI-a dovodi do rastuće apoptoze i diferencijacije i sve manje proliferacije . Kao posljedica toga, pacijenti koji razviju leukemiju bez visoke ekspresije MSI2 imaju bolju prognzu.

Dijagnostička i terapijska primjena[uredi | uredi izvor]

MIS2 je potencijalni biomarker raka kao i meta-lijeka.[16]

Također pogledajte[uredi | uredi izvor]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000153944 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000069769 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: Musashi RNA binding protein 2".
  6. ^ "UniProt, Q96DH6". Pristupljeno 12. 9. 2017.
  7. ^ a b de Andrés-Aguayo L, Varas F, Graf T (juli 2012). "Musashi 2 in hematopoiesis". Current Opinion in Hematology. 19 (4): 268–72. doi:10.1097/MOH.0b013e328353c778. PMID 22517588. S2CID 205827403.
  8. ^ a b c d Kharas MG, Lengner CJ, Al-Shahrour F, Bullinger L, Ball B, Zaidi S, Morgan K, Tam W, Paktinat M, Okabe R, Gozo M, Einhorn W, Lane SW, Scholl C, Fröhling S, Fleming M, Ebert BL, Gilliland DG, Jaenisch R, Daley GQ (august 2010). "Musashi-2 regulates normal hematopoiesis and promotes aggressive myeloid leukemia" (PDF). Nature Medicine. 16 (8): 903–8. doi:10.1038/nm.2187. hdl:1721.1/73937. PMC 3090658. PMID 20616797.
  9. ^ a b Sakakibara S, Nakamura Y, Satoh H, Okano H (oktobar 2001). "Rna-binding protein Musashi2: developmentally regulated expression in neural precursor cells and subpopulations of neurons in mammalian CNS". The Journal of Neuroscience. 21 (20): 8091–107. doi:10.1523/JNEUROSCI.21-20-08091.2001. PMC 6763847. PMID 11588182.
  10. ^ a b de Andrés-Aguayo L, Varas F, Kallin EM, Infante JF, Wurst W, Floss T, Graf T (juli 2011). "Musashi 2 is a regulator of the HSC compartment identified by a retroviral insertion screen and knockout mice". Blood. 118 (3): 554–64. doi:10.1182/blood-2010-12-322081. PMID 21613258.
  11. ^ https://www.genenames.org/data/hgnc_data.php?hgnc_id=18585
  12. ^ http://www.ebi.ac.uk/ena/data/view/AAH01526
  13. ^ Wuebben EL, Mallanna SK, Cox JL, Rizzino A (2012). "Musashi2 is required for the self-renewal and pluripotency of embryonic stem cells". PLOS ONE. 7 (4): e34827. doi:10.1371/journal.pone.0034827. PMC 3319613. PMID 22496868.
  14. ^ Ito T, Kwon HY, Zimdahl B, Congdon KL, Blum J, Lento WE, Zhao C, Lagoo A, Gerrard G, Foroni L, Goldman J, Goh H, Kim SH, Kim DW, Chuah C, Oehler VG, Radich JP, Jordan CT, Reya T (august 2010). "Regulation of myeloid leukaemia by the cell-fate determinant Musashi". Nature. 466 (7307): 765–8. doi:10.1038/nature09171. PMC 2918284. PMID 20639863.
  15. ^ Griner, LN; Reuther, GW (2010). "Aggressive myeloid leukemia formation is directed by the Musashi 2/Numb pathway" (PDF). Cancer Biology & Therapy. 10 (10): 979–982. doi:10.4161/cbt.10.10.14010. PMID 21084860. S2CID 8975004.
  16. ^ Melo JV, Barnes DJ (juni 2007). "Chronic myeloid leukaemia as a model of disease evolution in human cancer". Nature Reviews. Cancer. 7 (6): 441–53. doi:10.1038/nrc2147. PMID 17522713. S2CID 30599281.

Dopunska literatura[uredi | uredi izvor]