PCCA

S Wikipedije, slobodne enciklopedije
PCCA
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2CQY, 2JKU

Identifikatori
AliasiPCCA
Vanjski ID-jeviOMIM: 232000 MGI: 97499 HomoloGene: 236 GeneCards: PCCA
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za PCCA
Genomska lokacija za PCCA
Bend13q32.3Početak100,089,015 bp[1]
Kraj100,530,437 bp[1]
Lokacija gena (miš)
Hromosom 14 (miš)
Hrom.Hromosom 14 (miš)[2]
Hromosom 14 (miš)
Genomska lokacija za PCCA
Genomska lokacija za PCCA
Bend14 E5|14 65.99 cMPočetak122,771,736 bp[2]
Kraj123,128,512 bp[2]
Ontologija gena
Molekularna funkcija biotin binding
enzyme binding
nucleotide binding
ligase activity
ATP binding
propionyl-CoA carboxylase activity
metal ion binding
GO:0001948, GO:0016582 protein binding
Ćelijska komponenta citosol
mitochondrial matrix
mitohondrija
Biološki proces biotin metabolic process
short-chain fatty acid catabolic process
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)
NM_000282
NM_001127692
NM_001178004
NM_001352605
NM_001352606

NM_001352607
NM_001352608
NM_001352609
NM_001352610
NM_001352611
NM_001352612

NM_144844

RefSeq (bjelančevina)
NP_000273
NP_001121164
NP_001171475
NP_001339534
NP_001339535

NP_001339536
NP_001339537
NP_001339538
NP_001339539
NP_001339540
NP_001339541

NP_659093

Lokacija (UCSC)Chr 13: 100.09 – 100.53 MbChr 14: 122.77 – 123.13 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš
Propionil-CoA karboksilaza
Identifikatori
SimbolPPCA
CAS broj9023-94-3
Metilmalonil-CoA dekarboksilaza
Identifikatori
EC broj4.1.1.41
CAS broj37289-44-4
Baze podataka
IntEnzIntEnz pregled
BRENDABRENDA unos
ExPASyNiceZyme pregled
KEGGKEGG unos
MetaCycmetabolički put
PRIAMprofil
PDB struktureRCSB PDB PDBj PDBe PDBsum
Ontologija genaAmiGO / QuickGO
Pretraga
PMCčlanci
PubMedčlanci
NCBIproteini

Propionil-CoA karboksilaza (PCC) je enzim koji katalizira karboksilacijsku reakciju propionil CoA u mitohondrijskoj matrici. Enzim je ovisan o biotinu. Produkt reakcije je (S)-metilmalonil CoA. Propionil CoA je krajnji proizvod metabolizma masnih kiselina s neparnim lancem, a također je i metabolit većine razgranatih masnih kiselina s metilom. Takođe je glavni metabolit valina, a zajedno sa acetil-CoA je metabolit izoleucina, kao i metioninski metabolit. Propionil-CoA je stoga od velike važnosti kao prekursor glukoze. Životinjski (S)-metilmalonil-CoA se ne mogu direktno koristiti; na njega djeluje racemaza dajući (R)-metilmalonil-CoA. Potonji se pretvara metilmalonil-CoA mutazom (jednim od rijetkih enzima ovisnih o vitaminu B12 12 ) dajući sukcinil-CoA. Zatimse pretvara u oksaloacetat, pa u malat u Krebsovom ciklusu. Eksport malata u citosol dovodi do stvaranja oksaloacetata, fosfoenol-piruvata i drugih glukoneogenih intermedijera.

ATP + propionil-CoA + HCO3 ADP + fosfat + (S)-metilmalonil-CoA

Oba su klasificirana kao ligaze[5] i lijaze.[6]

Struktura enzima[uredi | uredi izvor]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 728 aminokiselina, a molekulska težina 80.059 Da.[7]

1020304050
MAGFWVGTAPLVAAGRRGRWPPQQLMLSAALRTLKHVLYYSRQCLMVSRN
LGSVGYDPNEKTFDKILVANRGEIACRVIRTCKKMGIKTVAIHSDVDASS
VHVKMADEAVCVGPAPTSKSYLNMDAIMEAIKKTRAQAVHPGYGFLSENK
EFARCLAAEDVVFIGPDTHAIQAMGDKIESKLLAKKAEVNTIPGFDGVVK
DAEEAVRIAREIGYPVMIKASAGGGGKGMRIAWDDEETRDGFRLSSQEAA
SSFGDDRLLIEKFIDNPRHIEIQVLGDKHGNALWLNERECSIQRRNQKVV
EEAPSIFLDAETRRAMGEQAVALARAVKYSSAGTVEFLVDSKKNFYFLEM
NTRLQVEHPVTECITGLDLVQEMIRVAKGYPLRHKQADIRINGWAVECRV
YAEDPYKSFGLPSIGRLSQYQEPLHLPGVRVDSGIQPGSDISIYYDPMIS
KLITYGSDRTEALKRMADALDNYVIRGVTHNIALLREVIINSRFVKGDIS
TKFLSDVYPDGFKGHMLTKSEKNQLLAIASSLFVAFQLRAQHFQENSRMP
VIKPDIANWELSVKLHDKVHTVVASNNGSVFSVEVDGSKLNVTSTWNLAS
PLLSVSVDGTQRTVQCLSREAGGNMSIQFLGTVYKVNILTRLAAELNKFM
LEKVTEDTSSVLRSPMPGVVVAVSVKPGDAVAEGQEICVIEAMKMQNSMT
AGKTGTVKSVHCQAGDTVGEGDLLVELE
Simboli

Opis[uredi | uredi izvor]

Propionil-CoA karboksilaza (PCC) je 750 kDa alfa (6) -beta (6)-dodekamer. (Samo približno 540 kDa je nativni enzim.[8]) Alfa podjedinice su raspoređene kao monomeri u centralnob beta-6 heksamernom jezgru. Spomenuto jezgro orijentirano je kao kratki cilindar s rupom duž svoje osi.

Alfa podjedinica PCC-a sadrži domene biotin-karboksilaza (BC) i biotinskog karboksilnog nosača proteina (BCCP). Domen poznat kao BT domen također se nalazi na alfa podjedinici i bitan je za interakcije sa beta podjedinicom. Lanac-8 antiparalelnog beta-bačvastog nabora ovog domena posebno je zanimljiv. Beta podjedinica ima aktivnost karboksiltransferaze (CT).[9]

a. Struktura himere RpPCCα-RdPCCβ, gledano niz osu trostruke simetrije. Domene u α i β podjedinicama u gornjoj polovini strukture imaju različite boje, a one u prvim α i β podjedinicama su označene. Podjedinice α i β u donjoj polovini obojene su u magenta i zeleno. Crvena strelica označava smjer gledanja ploče b.
(b). Struktura himere RpPCCα-RdPCCβ, gledano niz osu dvostruke simetrije. Crveni pravougao označava područje detaljno prikazano na slici 2a.
(c). Krio-EM rekonstrukcija HsPCC u rezoluciji 15 Å, gledano u istoj orijentaciji kao i ploča a. Atomski model himere uklopljen je u omotač krio-EM.
(d). Krio-EM rekonstrukcija gledana u istoj orijentaciji kao panel b. Strelice označavaju promjenu položaja BCCP-a koja je potrebna da se uklopi u krio-EM mapu. Sve strukturne figure proizvedene su s PyMOL-om (www.pymol.org), a krio-EM slike Chimerom.[10]
BC i CT mjesta udaljena su približno 55 Å, što ukazuje na to da se cijeli domen BCCP translocira tokom katalize karboksilacija propionil-CoA.[10] Ovo daje jasne dokaze o ključnoj dimernosti interakcija između alfa i beta podjedinica.
(a). Relativno pozicioniranje BC i CT aktivnih mjesta u holoenzimu. Prikazani su jedna α podjedinica i β2 dimer (β1 iz jednog sloja i β4 iz drugog sloja), a smjer gledanja je isti kao na slici 1b. Dva aktivna mjesta označena su zvijezdjcama, odvojenim udaljenošću od 55 Å. Prikazani su i vezani položaji ADP-a u kompleksu sa E. coli BC 18 i položaja CoA u kompleksu sa 12S podjedinicom transkarboksilaze 21.
(b). Detalji interakcije između BCCP-biotina i C domena β podjedinice. Interakcije vezivanja vodika označene su isprekidanim crvenim linijama. N1′ atom biotina označen je kao 1′, vodikom vezan za karbonil glavnog lanca Phe397.
(c). Molekulska površina CT aktivnog mjesta, prikazuje duboki usjek, gdje su vezane obje podloge.
(d). Shema CT aktivne lokacije.[10]

Džep PCC-a za vezivanje biotina je hidrofoban i visoko konzerviran. Biotin i propionil-CoA vezuju se okomito jedan na drugi u oksijanionskom udubini, koja sadrži aktivno mjesto. Utvrđeno je da je omjer nativnog enzima i biotina jedan mol nativni enzim na četiri mola biotina. Smatra se da je N1 biotina baza aktivnog mjesta.

Mutageneza usmjerena na lokus na D422 pokazuje promjenu specifičnosti supstrata za mjesto vezivanja propionil-CoA, što ukazuje na značaj ovog ostatka u katalitskoj aktivnosti PCC-a.[11] U 1979., inhibicijom fenilglioksala utvrđeno je da fosfatna grupa iz propionil-CoA ili ATP reagira esencijalnim ostatkom arginina na aktivnom mjestu tokom katalize.[12] Kasnije (2004.) predloženo je da arginin-338 služi za orijentaciju karboksifosfatnog intermedijara za optimalnu karboksilaciju biotina.[13]

KM utvrdila je da su vrijednosti ATP, propionil-CoA i bikarbonata 0,08 mM, odnosno 0,29 mM i 3,0 mM. Izoelektrična tačka pada na pH 5,5. Strukturni integritet PCC -a očuvan je u temperaturnom rasponu od –50 do 37 stepeni Celzijusa i rasponu pH od 6,2 do 8,8. Pokazalo se da je optimalni pH između 7,2 i 8,8 bez vezanog biotina, Sa biotinom, optimalni pH je 8,0-8,5.[14]

Enzimski mehanizam[uredi | uredi izvor]

Uobičajeni mehanizam katalitske reakcije uključuje karbanionski međuproizvod i ne prolazi kroz usklađen proces.[15] Slijedeća slika prikazuje vjerovatni put.

Vjerovatni mehanizam PCC

Pokazalo se da je reakcija blago reverzibilna, pri niskom protoku propionil-CoA.[16]

Izozimi[uredi | uredi izvor]

Ljudi eksprimiraju sljedeće dvije propionil-CoA karboksilaznih izoenzima:

Propionil koenzim A karboksilaza, polpeptid alfa
Identifikatori
SimbolPCCA
NCBI gen5095
HGNC8653
OMIM232000
RefSeqNM_000282
UniProtP05165
Ostali podaci
EC broj6.4.1.3
LokusHrom. 13 q32
Pretraga za
StruktureSwiss-model
DomeneInterPro
Propionil koenzim A karboksilaza, polipeptid beta
Identifikatori
SimbolPCCB
NCBI gen5096
HGNC8654
OMIM232050
RefSeqNM_000532
UniProtP05166
Ostali podaci
EC broj6.4.1.3
LokusHrom. 3 q21-q22
Pretraga za
StruktureSwiss-model
DomeneInterPro

Patologija[uredi | uredi izvor]

Nedostatak je povezan s propionskom acidemijom. [17][18][19]

Aktivnost PCC je najosjetljiviji pokazatelj statusa biotina koji je do sada testiran. U budućim studijama trudnoće upotreba podataka o aktivnosti PCC-a limfocita trebala bi se pokazati vrijednom za procjenu statusa biotina.[20]

Unutargenska komplementacija[uredi | uredi izvor]

Kada više kopija polipeptida kodiranog genom tvori agregat, ova proteinska struktura naziva se multimer. Kada se multimer formira od polipeptida koje proizvode dva različita mutantna alela određenog gena, mješoviti multimer može pokazati veću funkcionalnu aktivnost od nepomiješanih multimera koje tvori svaki od mutanata. U tom slučaju, fenomen se naziva intragenska komplementacija.

PCC je heteropolimer, sastavljen od α i β podjedinica u strukturi α6β6. Mutacija u PCC -u, bilo u α (PCCα) ili β podjedinici (PCCβ) može uzrokovati propionsku acidemiju kod ljudi. Kada su različite ćelijske linije kožnih fibroblasta s kožnomdefektnom PCCβ spojene u parovima, β heteromultimerni protein, nastao kao njena posljedica često je pokazivao viši nivo aktivnosti nego što bi se očekivalo na osnovu aktivnosti roditeljskih enzima.[21] Ovaj nalaz intragenske komplementacije) pokazao je da multimerna struktura PCC-a omogućava kooperativne interakcije između sastavnih monomera PCCβ koji mogu generirati funkcionalniji oblik holoenzima.

Regulacija[uredi | uredi izvor]

Propionil-CoA karboksilazom[uredi | uredi izvor]

a. Karbamazepin (antiepileptik): značajno snižava nivo enzima u jetri[22]

b. E. coli šaperoninski proteini groES i groEL: neophodni za presavijanje i sastavljanje ljudskih PCC heteromerijskih podjedinica[23]

c. Bikarbonat: negativna kooperativnost[13]

d. Mg2+ i MgATP2−: alosterna aktivacija[24]

Propionyl-CoA karboksilazom[uredi | uredi izvor]

a. 6-deokseritronolid B: smanjenje nivoa PCC-a dovodi do povećane proizvodnje [25]

b. Glukokinaza u beta ćelijama pankreasa: prekursor beta-PCC pokazao je smanjenje KM i povećanje Vmax; aktivacija [26]

Također pogledajte[uredi | uredi izvor]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000175198 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000041650 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ EC 6.4.1.3
  6. ^ EC 4.1.1.41
  7. ^ "UniProt, P05165". Pristupljeno 2021-08-04. CS1 održavanje: nepreporučeni parametar (link)
  8. ^ Kalousek F, Darigo MD, Rosenberg LE (1980). "Isolation and characterization of propionyl-CoA carboxylase from normal human liver. Evidence for a protomeric tetramer of nonidentical subunits". The Journal of Biological Chemistry. 255 (1): 60–65. PMID 6765947.
  9. ^ Diacovich L, Mitchell DL, Pham H, Gago G, Melgar MM, Khosla C, Gramajo H, Tsai SC (2004). "Crystal Structure of theβ-Subunit of Acyl-CoA Carboxylase: Structure-Based Engineering of Substrate Specificity†,‡". Biochemistry. 43 (44): 14027–14036. doi:10.1021/bi049065v. PMID 15518551.
  10. ^ a b c Huang CS, Sadre-Bazzaz K, Shen Y, Deng B, Zhou ZH, Tong L (2010). "Crystal structure of the α6β6 holoenzyme of propionyl-coenzyme a carboxylase". Nature. 466 (7309): 1001–1005. doi:10.1038/nature09302. PMC 2925307. PMID 20725044.
  11. ^ Arabolaza A, Shillito ME, Lin TW, Diacovich L, Melgar M, Pham H, Amick D, Gramajo H, Tsai SC (2010). "Crystal Structures and Mutational Analyses of Acyl-CoA Carboxylase β Subunit of Streptomyces coelicolor". Biochemistry. 49 (34): 7367–7376. doi:10.1021/bi1005305. PMC 2927733. PMID 20690600.
  12. ^ Wolf B, Kalousek F, Rosenberg LE (1979). "Essential arginine residues in the active sites of propionyl CoA carboxylase and beta-methylcrotonyl CoA carboxylase". Enzyme. 24 (5): 302–306. doi:10.1159/000458679. PMID 510274.
  13. ^ a b Sloane V, Waldrop GL (2004). "Kinetic characterization of mutations found in propionic acidemia and methylcrotonylglycinuria: evidence for cooperativity in biotin carboxylase". Journal of Biological Chemistry. 279 (16): 15772–15778. doi:10.1074/jbc.M311982200. PMID 14960587.
  14. ^ Hsia YE, Scully KJ, Rosenberg LE (1979). "Human propionyl CoA carboxylase: Some properties of the partially purified enzyme in fibroblasts from controls and patients with propionic acidemia". Pediatric Research. 13 (6): 746–751. doi:10.1203/00006450-197906000-00005. PMID 481943.
  15. ^ Stubbe J, Fish S, Abeles RH (1980). "Are carboxylations involving biotin concerted or nonconcerted?". The Journal of Biological Chemistry. 255 (1): 236–242. PMID 7350155.
  16. ^ Reszko AE, Kasumov T, Pierce BA, David F, Hoppel CL, Stanley WC, Des Rosiers C, Brunengraber H (2003). "Assessing the Reversibility of the Anaplerotic Reactions of the Propionyl-CoA Pathway in Heart and Liver". Journal of Biological Chemistry. 278 (37): 34959–34965. doi:10.1074/jbc.M302013200. PMID 12824185.
  17. ^ Ugarte M, Pérez-Cerdá C, Rodríguez-Pombo P, Desviat LR, Pérez B, Richard E, Muro S, Campeau E, Ohura T, Gravel RA (1999). "Overview of mutations in thePCCA and PCCB genes causing propionic acidemia". Human Mutation. 14 (4): 275–282. doi:10.1002/(SICI)1098-1004(199910)14:4<275::AID-HUMU1>3.0.CO;2-N. PMID 10502773.
  18. ^ Desviat LR, Pérez B, Pérez-Cerdá C, Rodríguez-Pombo P, Clavero S, Ugarte M (2004). "Propionic acidemia: Mutation update and functional and structural effects of the variant alleles". Molecular Genetics and Metabolism. 83 (1–2): 28–37. doi:10.1016/j.ymgme.2004.08.001. PMID 15464417.
  19. ^ Deodato, F.; Boenzi, S.; Santorelli, F. M.; Dionisi-Vici, C. (2006). "Methylmalonic and propionic aciduria". American Journal of Medical Genetics Part C. 142C (2): 104–112. doi:10.1002/ajmg.c.30090. PMID 16602092. S2CID 21114631.
  20. ^ Stratton SL, Bogusiewicz A, Mock MM, Mock NI, Wells AM, Mock DM (2006). "Lymphocyte propionyl-CoA carboxylase and its activation by biotin are sensitive indicators of marginal biotin deficiency in humans". The American Journal of Clinical Nutrition. 84 (2): 384–388. doi:10.1093/ajcn/84.1.384. PMC 1539098. PMID 16895887.
  21. ^ Rodríguez-Pombo P, Pérez-Cerdá C, Pérez B, Desviat LR, Sánchez-Pulido L, Ugarte M. Towards a model to explain the intragenic complementation in the heteromultimeric protein propionyl-CoA carboxylase. Biochim Biophys Acta. 2005;1740(3):489-498. doi:10.1016/j.bbadis.2004.10.009
  22. ^ Rathman SC, Eisenschenk S, McMahon RJ (2002). "The abundance and function of biotin-dependent enzymes are reduced in rats chronically administered carbamazepine". The Journal of Nutrition. 132 (11): 3405–3410. doi:10.1093/jn/132.11.3405. PMID 12421859.
  23. ^ Kelson TL, Ohura T, Kraus JP (1996). "Chaperonin-mediated assembly of wild-type and mutant subunits of human propionyl-CoA carboxylase expressed in Escherichia coli". Human Molecular Genetics. 5 (3): 331–337. doi:10.1093/hmg/5.3.331. PMID 8852656.
  24. ^ McKeon C, Wolf B (1982). "Magnesium and magnesium adenosine triphosphate activation of human propionyl CoA carboxylase and beta-methylcrotonyl CoA carboxylase". Enzyme. 28 (1): 76–81. doi:10.1159/000459088. PMID 6981505.
  25. ^ Zhang H, Boghigian BA, Pfeifer BA (2010). "Investigating the role of native propionyl-CoA and methylmalonyl-CoA metabolism on heterologous polyketide production inEscherichia coli". Biotechnology and Bioengineering. 105 (3): 567–573. doi:10.1002/bit.22560. PMID 19806677. S2CID 659042.
  26. ^ Shiraishi A, Yamada Y, Tsuura Y, Fijimoto S, Tsukiyama K, Mukai E, Toyoda Y, Miwa I, Seino Y (2000). "A novel glucokinase regulator in pancreatic beta cells: precursor of propionyl-CoA carboxylase beta subunit interacts with glucokinase and augments its activity". Journal of Biological Chemistry. 276 (4): 2325–2328. doi:10.1074/jbc.C000530200. PMID 11085976.

Vanjski linkovi[uredi | uredi izvor]


Šablon:Enzimi za metabolizam aminokiselina Šablon:Ligaze ugljik-ugljik