RCBTB2

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
RCBTB2
Identifikatori
AliasiRCBTB2
Vanjski ID-jeviOMIM: 603524 MGI: 1917200 HomoloGene: 970 GeneCards: RCBTB2
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za RCBTB2
Genomska lokacija za RCBTB2
Bend13q14.2Početak48,488,963 bp[1]
Kraj48,533,256 bp[1]
Lokacija gena (miš)
Hromosom 14 (miš)
Hrom.Hromosom 14 (miš)[2]
Hromosom 14 (miš)
Genomska lokacija za RCBTB2
Genomska lokacija za RCBTB2
Bend14|14 D3Početak73,360,477 bp[2]
Kraj73,445,283 bp[2]
Obrazac RNK ekspresije
PBB GE RCBTB2 204759 at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 protein binding
Ćelijska komponenta Akrozom
GO:0016023 citoplazmatska vezikula
Biološki proces regulation of molecular function
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)
NM_001268
NM_001286830
NM_001286831
NM_001286832
NM_001352424

NM_001352425
NM_001352426
NM_001352427
NM_001352428
NM_001352429
NM_001352430
NM_001352431

NM_001170694
NM_134083

RefSeq (bjelančevina)
NP_001259
NP_001273759
NP_001273760
NP_001273761
NP_001339353

NP_001339354
NP_001339355
NP_001339356
NP_001339357
NP_001339358
NP_001339359
NP_001339360

NP_001164165
NP_598844

Lokacija (UCSC)Chr 13: 48.49 – 48.53 MbChr 14: 73.36 – 73.45 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

RCC1 i BTB protein 2 sa domenom je protein koji je kod ljudi kodiran genom RCBTB2.[5][6]

Ovaj gen kodira člana porodice GEF, povezane sa RCC1. N-terminalna polovina kodirane aminokiselinske sekvence pokazuje sličnost s regulatorom kondenzacije hromosoma RCC1, koji djeluje kao faktor izmjene guaninskih nukleotida (GEF) za Ras srodnu GTPazu Ran.[6]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 551 aminokiselina, a molekulska težina 60.315 Da.[7].

1020304050
MEEELPLFSGDSGKPVQATLSSLKMLDVGKWPIFSLCSEEELQLIRQACV
FGSAGNEVLYTTVNDEIFVLGTNCCGCLGLGDVQSTIEPRRLDSLNGKKI
ACLSYGSGPHIVLATTEGEVFTWGHNAYSQLGNGTTNHGLVPCHISTNLS
NKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTVNQPIPRRVTG
CLQNKVVVTIACGQMCCMAVVDTGEVYVWGYNGNGQLGLGNSGNQPTPCR
VAALQGIRVQRVACGYAHTLVLTDEGQVYAWGANSYGQLGTGNKSNQSYP
TPVTVEKDRIIEIAACHSTHTSAAKTQGGHVYMWGQCRGQSVILPHLTHF
SCTDDVFACFATPAVTWRLLSVEPDDHLTVAESLKREFDNPDTADLKFLV
DGKYIYAHKVLLKIRCEHFRSSLEDNEDDIVEMSEFSYPVYRAFLEYLYT
DSISLSPEEAVGLLDLATFYRENRLKKLCQQTIKQGICEENAIALLSAAV
KYDAQDLEEFCFRFCINHLTVVTQTSGFAEMDHDLLKNFISKASRVGAFK
N
Simboli

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000136161 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000022106 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Devilder MC, Cadoret E, Cherel M, Moreau I, Rondeau G, Bezieau S, Moisan JP (Jan 1999). "cDNA cloning, gene characterization and 13q14.3 chromosomal assignment of CHC1-L, a chromosome condensation regulator-like guanine nucleotide exchange factor". Genomics. 54 (1): 99–106. doi:10.1006/geno.1998.5498. PMID 9806834.
  6. ^ a b "Entrez Gene: RCBTB2 regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2".
  7. ^ "UniProt, O95199". Pristupljeno 2021-08-04. CS1 održavanje: nepreporučeni parametar (link)

Dopunska literatura[uredi | uredi izvor]