RGCC

S Wikipedije, slobodne enciklopedije
RGCC
Identifikatori
AliasiRGCC
Vanjski ID-jeviOMIM: 610077 MGI: 1913464 HomoloGene: 8544 GeneCards: RGCC
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za RGCC
Genomska lokacija za RGCC
Bend13q14.11Početak41,457,550 bp[1]
Kraj41,470,871 bp[1]
Lokacija gena (miš)
Hromosom 14 (miš)
Hrom.Hromosom 14 (miš)[2]
Hromosom 14 (miš)
Genomska lokacija za RGCC
Genomska lokacija za RGCC
Bend14|14 D3Početak79,526,196 bp[2]
Kraj79,539,085 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija R-SMAD binding
protein kinase activator activity
GO:0001948, GO:0016582 vezivanje za proteine
protein kinase binding
Ćelijska komponenta citoplazma
centrosom
centar organizacije mikrotubula
citoskelet
jedro
citosol
Jedarce
Biološki proces positive regulation of collagen biosynthetic process
negative regulation of blood vessel endothelial cell migration
negative regulation of cell-cell adhesion mediated by cadherin
complement activation
positive regulation of extracellular matrix assembly
positive regulation of DNA-binding transcription factor activity
negative regulation of mitotic cell cycle phase transition
positive regulation of epithelial to mesenchymal transition
positive regulation of extracellular matrix constituent secretion
regulation of cell cycle
negative regulation of endothelial cell proliferation
positive regulation of endothelial cell apoptotic process
GO:1901313 positive regulation of gene expression
positive regulation of DNA biosynthetic process
negative regulation of angiogenesis
ćelijski ciklus
fibroblast activation
negative regulation of exit from mitosis
positive regulation of mitotic nuclear division
cellular response to hypoxia
negative regulation of fibroblast growth factor production
positive regulation of stress fiber assembly
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
negative regulation of cell population proliferation
activation of protein kinase activity
DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
positive regulation of cyclin-dependent protein serine/threonine kinase activity
positive regulation of G1/S transition of mitotic cell cycle
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_014059

NM_025427

RefSeq (bjelančevina)

NP_054778

NP_079703

Lokacija (UCSC)Chr 13: 41.46 – 41.47 MbChr 14: 79.53 – 79.54 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Regulator ćelijskog ciklusa RGCC (RGCC), znan i kao odgovorni gen za protrinski komplement 3 (RGC-32) je protein koji je kod ljudi kodiran genom RGCC.[5][6][7]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 137 aminokiselina, a molekulska težina 14.559 Da.[8].

1020304050
MKPPAAQGSPAAAAAAAPALDSAAAEDLSDALCEFDAVLADFASPFHERH
FHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTD
STPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM
Simboli

Funkcija[uredi | uredi izvor]

Smatra se da ovaj gen regulira napredovanje ćelijskog ciklusa. Izaziva ga p53, kao odgovor na oštećenje DNK, ili subrazgrađujuće nivoe proteinskog sistema komplementa koji rezultiraju aktivacijom ćelijskog ciklusa. Kodirani protein se lokalizira u citoplazmi, tokom interfaze i u centrosomima tokom mitoza. Protein formira kompleks s polo-lika kinaza 1. Protein se također translocira u jedro, kao odgovor na liječenje proteinima komplementnog sistema, a može se povezati i povećati aktivnost kinaze ciklusa ćelijske diobe dva proteina. U različitim testovima i tipovima ćelija pokazalo se da prekomjerna ekspresija ovog proteina aktivira ili suzbija napredovanje ćelijskog ciklusa.[7]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000102760 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000022018 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Saigusa K, Imoto I, Tanikawa C, Aoyagi M, Ohno K, Nakamura Y, Inazawa J (Feb 2007). "RGC32, a novel p53-inducible gene, is located on centrosomes during mitosis and results in G2/M arrest". Oncogene. 26 (8): 1110–21. doi:10.1038/sj.onc.1210148. PMID 17146433.
  6. ^ Huang WY, Li ZG, Rus H, Wang X, Jose PA, Chen SY (Mar 2009). "RGC-32 mediates transforming growth factor-beta-induced epithelial-mesenchymal transition in human renal proximal tubular cells". J Biol Chem. 284 (14): 9426–32. doi:10.1074/jbc.M900039200. PMC 2666595. PMID 19158077.
  7. ^ a b "Entrez Gene: RGC32 response gene to complement 32".
  8. ^ "UniProt, Q9H4X1". Pristupljeno 5. 8. 2021.

Dopunska literatura[uredi | uredi izvor]