RIPK2

S Wikipedije, slobodne enciklopedije
RIPK2
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

4C8B, 2N7Z, 5AR3, 5AR2, 5AR7, 5AR8, 5AR5, 5AR4, 2N83, 5J7B, 5J79

Identifikatori
AliasiRIPK2
Vanjski ID-jeviOMIM: 603455 MGI: 1891456 HomoloGene: 37856 GeneCards: RIPK2
EC broj2.7.10.2
Lokacija gena (čovjek)
Hromosom 8 (čovjek)
Hrom.Hromosom 8 (čovjek)[1]
Hromosom 8 (čovjek)
Genomska lokacija za RIPK2
Genomska lokacija za RIPK2
Bend8q21.3Početak89,757,806 bp[1]
Kraj89,791,064 bp[1]
Lokacija gena (miš)
Hromosom 4 (miš)
Hrom.Hromosom 4 (miš)[2]
Hromosom 4 (miš)
Genomska lokacija za RIPK2
Genomska lokacija za RIPK2
Bend4 A2|4 6.7 cMPočetak16,122,733 bp[2]
Kraj16,163,647 bp[2]
Obrazac RNK ekspresije


Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija LIM domain binding
kinase activity
CARD domain binding
signaling receptor binding
ATP binding
protein kinase activity
non-membrane spanning protein tyrosine kinase activity
transferase activity
protein homodimerization activity
GO:0001948, GO:0016582 vezivanje za proteine
nucleotide binding
signal transducer activity
protein serine/threonine kinase activity
vezivanje identičnih proteina
caspase binding
JUN kinase kinase kinase activity
Ćelijska komponenta citoplazma
citoskelet
Vezikula
citosol
GO:0009327 makromolekulani kompleks
Biološki proces response to interleukin-1
positive regulation of cytokine-mediated signaling pathway
response to exogenous dsRNA
positive regulation of JNK cascade
positive regulation of xenophagy
cellular response to muramyl dipeptide
protein phosphorylation
positive regulation of ERK1 and ERK2 cascade
cellular response to peptidoglycan
positive regulation of stress-activated MAPK cascade
GO:0051637 defense response to Gram-positive bacterium
GO:0097285 apoptoza
regulation of apoptotic process
positive regulation of immature T cell proliferation
positive regulation of interleukin-12 production
positive regulation of interferon-alpha production
positive regulation of peptidyl-serine phosphorylation
JNK cascade
response to interleukin-12
nucleotide-binding oligomerization domain containing 2 signaling pathway
positive regulation of T-helper 1 type immune response
positive regulation of alpha-beta T cell proliferation
positive regulation of interleukin-6 production
positive regulation of tumor necrosis factor production
positive regulation of peptidyl-tyrosine phosphorylation
inflammatory response
I-kappaB kinase/NF-kappaB signaling
nucleotide-binding oligomerization domain containing 1 signaling pathway
positive regulation of interferon-beta production
Fosforilacija
immune system process
positive regulation of T-helper 1 cell differentiation
negative regulation of apoptotic process
cellular response to lipoteichoic acid
positive regulation of interleukin-2 production
positive regulation of chemokine production
nucleotide-binding oligomerization domain containing signaling pathway
positive regulation of protein ubiquitination
lipopolysaccharide-mediated signaling pathway
positive regulation of interferon-gamma production
T cell proliferation
positive regulation of peptidyl-threonine phosphorylation
positive regulation of apoptotic process
positive regulation of I-kappaB kinase/NF-kappaB signaling
peptidyl-tyrosine phosphorylation
cellular response to lipopolysaccharide
T cell receptor signaling pathway
response to interleukin-18
GO:0072468 Transdukcija signala
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
toll-like receptor 4 signaling pathway
toll-like receptor 2 signaling pathway
Urođeni imunski sistem
MAPK cascade
adaptive immune response
positive regulation of protein binding
positive regulation of NF-kappaB transcription factor activity
activation of cysteine-type endopeptidase activity
positive regulation of cell death
interleukin-1-mediated signaling pathway
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_003821
NM_001375360

NM_138952
NM_001329751

RefSeq (bjelančevina)

NP_003812
NP_001362289

NP_001316680
NP_620402

Lokacija (UCSC)Chr 8: 89.76 – 89.79 MbChr 4: 16.12 – 16.16 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Receptor-interaktivna serin/treonine-protein kinaza 2 jest enzim koji je kod ljudi kodiran genom RIPK2 sa hromosoma 8.[5][6][7]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 540 aminokiselina, a molekulska težina 61.195 Da.[7]

1020304050
MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLH
IHTPLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPN
GSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQ
NILLDNEFHVKIADFGLSKWRMMSLSQSRSSKSAPEGGTIIYMPPENYEP
GQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVI
NEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEI
TFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQ
LHENSGSPETSRSLPAPQDNDFLSRKAQDCYFMKLHHCPGNHSWDSTISG
SQRAAFCDHKTTPCSSAIINPLSTAGNSERLQPGIAQQWIQSKREDIVNQ
MTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEE
FAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM

Funkcija[uredi | uredi izvor]

Ovaj gen kodira člana porodice proteina serin/treonin protein-kinaza s interakcijom s receptorom (RIP). Kodirani protein sadrži C-terminalni domen regrutacije kaspaze (CARD) i komponenta je signalnih kompleksa, kako u urođenom tako iu adaptivnom imunskom putu. Potentan je aktivator NF-κB i induktor apoptoze kao odgovor na različite podražaje.[7]

Interakcije[uredi | uredi izvor]

Pokazalo se da RIPK2 reaguje sa BIRC2.[6][8]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000104312 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000041135 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Inohara N, del Peso L, Koseki T, Chen S, Nunez G (Jun 1998). "RICK, a novel protein kinase containing a caspase recruitment domain, interacts with CLARP and regulates CD95-mediated apoptosis". J Biol Chem. 273 (20): 12296–300. doi:10.1074/jbc.273.20.12296. PMID 9575181.
  6. ^ a b Thome M, Hofmann K, Burns K, Martinon F, Bodmer JL, Mattmann C, Tschopp J (Nov 1998). "Identification of CARDIAK, a RIP-like kinase that associates with caspase-1". Curr Biol. 8 (15): 885–8. doi:10.1016/S0960-9822(07)00352-1. PMID 9705938. S2CID 1235278.
  7. ^ a b c "Entrez Gene: RIPK2 receptor-interacting serine-threonine kinase 2".
  8. ^ McCarthy, J V; Ni J; Dixit V M (Jul 1998). "RIP2 is a novel NF-kappaB-activating and cell death-inducing kinase". J. Biol. Chem. United States. 273 (27): 16968–75. doi:10.1074/jbc.273.27.16968. ISSN 0021-9258. PMID 9642260.

Dopunska literatura[uredi | uredi izvor]