RPA2

S Wikipedije, slobodne enciklopedije
RPA2
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1DPU, 1L1O, 1QUQ, 1Z1D, 2PI2, 2PQA, 2Z6K, 3KDF, 4MQV, 4OU0

Identifikatori
AliasiRPA2
Vanjski ID-jeviOMIM: 179836 MGI: 1339939 HomoloGene: 37712 GeneCards: RPA2
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za RPA2
Genomska lokacija za RPA2
Bend1p35.3Početak27,891,524 bp[1]
Kraj27,914,746 bp[1]
Lokacija gena (miš)
Hromosom 4 (miš)
Hrom.Hromosom 4 (miš)[2]
Hromosom 4 (miš)
Genomska lokacija za RPA2
Genomska lokacija za RPA2
Bend4|4 D2.3Početak132,495,643 bp[2]
Kraj132,506,063 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija vezivanje sa DNK
protein N-terminus binding
single-stranded DNA binding
oštećeno vezivanje sa DNK
GO:0001948, GO:0016582 vezivanje za proteine
vezivanje enzima
protein phosphatase binding
ubiquitin protein ligase binding
G-rich strand telomeric DNA binding
double-stranded DNA binding
sequence-specific DNA binding
Ćelijska komponenta site of double-strand break
PML body
nukleoplazma
Telomera
Replikacijski protein A
Hromatin
jedro
nuclear body
kondenzovani nuklearni hromosom
Biološki proces nucleotide-excision repair, DNA gap filling
DNA recombination
interstrand cross-link repair
regulation of double-strand break repair via homologous recombination
error-free translesion synthesis
G1 faza
error-prone translesion synthesis
cellular response to DNA damage stimulus
Replikacija DNK
mitotic G1 DNA damage checkpoint signaling
regulation of DNA damage checkpoint
regulation of cellular response to heat
Popravak neusklađenosti DNK
translesion synthesis
transcription-coupled nucleotide-excision repair
nucleotide-excision repair, DNA incision
base-excision repair
Popravak ekscizijom nukleotida
nucleotide-excision repair, preincision complex stabilization
regulation of signal transduction by p53 class mediator
GO:0100026 Popravka DNK
double-strand break repair via homologous recombination
nucleotide-excision repair, preincision complex assembly
nucleotide-excision repair, DNA incision, 5'-to lesion
nucleotide-excision repair, DNA incision, 3'-to lesion
protein localization to chromosome
telomere maintenance
telomere maintenance via semi-conservative replication
G1/S transition of mitotic cell cycle
telomere maintenance via recombination
DNA topological change
DNA unwinding involved in DNA replication
mitotic recombination
telomere maintenance via telomerase
reciprocal meiotic recombination
heteroduplex formation
positive regulation of helicase activity
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001286076
NM_001297558
NM_002946
NM_001355128
NM_001355129

NM_011284

RefSeq (bjelančevina)

NP_001273005
NP_001284487
NP_002937
NP_001342057
NP_001342058

n/a

Lokacija (UCSC)Chr 1: 27.89 – 27.91 MbChr 4: 132.5 – 132.51 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Kilodaltonska podjedinica replikacijskog proteina A 32 jest protein koji je kod ljudi kodiran genom RPA2 sa hromosoma 1.[5][6]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 270 aminokiselina, a molekulska težina 29.247 Da.[7]

1020304050
MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCT
ISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAA
PMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLE
DMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFM
PANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLS
NEGHIYSTVDDDHFKSTDAE

Interakcije[uredi | uredi izvor]

Pokazalo se da RPA2 reaguje sa:

Također pogledajte[uredi | uredi izvor]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000117748 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000028884 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Umbricht CB, Erdile LF, Jabs EW, Kelly TJ (Mar 1993). "Cloning, overexpression, and genomic mapping of the 14-kDa subunit of human replication protein A". The Journal of Biological Chemistry. 268 (9): 6131–8. doi:10.1016/S0021-9258(18)53229-4. PMID 8454588.
  6. ^ "Entrez Gene: RPA2 Replication protein A2, 32kDa".
  7. ^ "UniProt, P15927" (jezik: eng.). Pristupljeno 4. 12. 2021.CS1 održavanje: nepoznati jezik (link)
  8. ^ Otterlei M, Warbrick E, Nagelhus TA, Haug T, Slupphaug G, Akbari M, Aas PA, Steinsbekk K, Bakke O, Krokan HE (Jul 1999). "Post-replicative base excision repair in replication foci". The EMBO Journal. 18 (13): 3834–44. doi:10.1093/emboj/18.13.3834. PMC 1171460. PMID 10393198.
  9. ^ a b c Shao RG, Cao CX, Zhang H, Kohn KW, Wold MS, Pommier Y (Mar 1999). "Replication-mediated DNA damage by camptothecin induces phosphorylation of RPA by DNA-dependent protein kinase and dissociates RPA:DNA-PK complexes". The EMBO Journal. 18 (5): 1397–406. doi:10.1093/emboj/18.5.1397. PMC 1171229. PMID 10064605.
  10. ^ Sukhodolets KE, Hickman AB, Agarwal SK, Sukhodolets MV, Obungu VH, Novotny EA, Crabtree JS, Chandrasekharappa SC, Collins FS, Spiegel AM, Burns AL, Marx SJ (Jan 2003). "The 32-kilodalton subunit of replication protein A interacts with menin, the product of the MEN1 tumor suppressor gene". Molecular and Cellular Biology. 23 (2): 493–509. doi:10.1128/mcb.23.2.493-509.2003. PMC 151531. PMID 12509449.
  11. ^ a b Bochkareva E, Korolev S, Lees-Miller SP, Bochkarev A (Apr 2002). "Structure of the RPA trimerization core and its role in the multistep DNA-binding mechanism of RPA". The EMBO Journal. 21 (7): 1855–63. doi:10.1093/emboj/21.7.1855. PMC 125950. PMID 11927569.
  12. ^ Bochkareva E, Frappier L, Edwards AM, Bochkarev A (Feb 1998). "The RPA32 subunit of human replication protein A contains a single-stranded DNA-binding domain". The Journal of Biological Chemistry. 273 (7): 3932–6. doi:10.1074/jbc.273.7.3932. PMID 9461578.
  13. ^ Kim J, Kim D, Chung J (2000). "Replication protein a 32 kDa subunit (RPA p32) binds the SH2 domain of STAT3 and regulates its transcriptional activity". Cell Biology International. 24 (7): 467–73. doi:10.1006/cbir.2000.0525. PMID 10875894. S2CID 23783745.
  14. ^ Yoo E, Kim BU, Lee SY, Cho CH, Chung JH, Lee CH (Aug 2005). "53BP1 is associated with replication protein A and is required for RPA2 hyperphosphorylation following DNA damage". Oncogene. 24 (35): 5423–30. doi:10.1038/sj.onc.1208710. PMID 15856006.
  15. ^ Nagelhus TA, Haug T, Singh KK, Keshav KF, Skorpen F, Otterlei M, Bharati S, Lindmo T, Benichou S, Benarous R, Krokan HE (Mar 1997). "A sequence in the N-terminal region of human uracil-DNA glycosylase with homology to XPA interacts with the C-terminal part of the 34-kDa subunit of replication protein A". The Journal of Biological Chemistry. 272 (10): 6561–6. doi:10.1074/jbc.272.10.6561. PMID 9045683.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]