SCN5A

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
SCN5A
Protein SCN5A PDB 1byy.png
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2KBI, 2L53, 4DCK, 4DJC, 4JQ0, 4OVN

Identifikatori
AliasiSCN5A
Vanjski ID-jeviOMIM: 600163 MGI: 98251 HomoloGene: 22738 GeneCards: SCN5A
Lokacija gena (čovjek)
Hromosom 3 (čovjek)
Hrom.Hromosom 3 (čovjek)[1]
Hromosom 3 (čovjek)
Genomska lokacija za SCN5A
Genomska lokacija za SCN5A
Bend3p22.2Početak38,548,057 bp[1]
Kraj38,649,687 bp[1]
Lokacija gena (miš)
Hromosom 9 (miš)
Hrom.Hromosom 9 (miš)[2]
Hromosom 9 (miš)
Genomska lokacija za SCN5A
Genomska lokacija za SCN5A
Bend9 F3|9 71.33 cMPočetak119,312,474 bp[2]
Kraj119,408,082 bp[2]
Ontologija gena
Molekularna funkcija nitric-oxide synthase binding
transmembrane transporter binding
protein domain specific binding
voltage-gated sodium channel activity involved in AV node cell action potential
voltage-gated sodium channel activity involved in bundle of His cell action potential
sodium channel activity
voltage-gated sodium channel activity involved in SA node cell action potential
voltage-gated ion channel activity
ion channel activity
voltage-gated sodium channel activity involved in Purkinje myocyte action potential
GO:0001948 protein binding
ankyrin binding
enzyme binding
fibroblast growth factor binding
voltage-gated sodium channel activity involved in cardiac muscle cell action potential
scaffold protein binding
protein kinase binding
ubiquitin protein ligase binding
voltage-gated sodium channel activity
calmodulin binding
Ćelijska komponenta voltage-gated sodium channel complex
integral component of membrane
lateral plasma membrane
membrana
Interkalirani disk
T-tubule
intracellular anatomical structure
cell surface
Z disc
Endoplazmatski retikulum
Kaveole
Sarkolema
Ćelijska membrana
citoplazma
perinuklearno područje citoplazme
Akson
Biološki proces regulation of atrial cardiac muscle cell membrane repolarization
cellular response to calcium ion
membrane depolarization during AV node cell action potential
regulation of ventricular cardiac muscle cell membrane depolarization
membrane depolarization during Purkinje myocyte cell action potential
membrane depolarization during bundle of His cell action potential
membrane depolarization during action potential
cardiac muscle contraction
sodium ion transmembrane transport
sodium ion transport
positive regulation of epithelial cell proliferation
SA node cell action potential
brainstem development
cardiac ventricle development
regulation of atrial cardiac muscle cell membrane depolarization
membrane depolarization
ventricular cardiac muscle cell action potential
bundle of His cell action potential
cardiac muscle cell action potential involved in contraction
regulation of ion transmembrane transport
ion transport
cerebellum development
regulation of heart rate
odontogenesis of dentin-containing tooth
positive regulation of action potential
regulation of cardiac muscle cell contraction
telencephalon development
AV node cell to bundle of His cell communication
transmembrane transport
positive regulation of sodium ion transport
membrane depolarization during SA node cell action potential
response to denervation involved in regulation of muscle adaptation
regulation of sodium ion transmembrane transport
AV node cell action potential
regulation of heart rate by cardiac conduction
membrane depolarization during cardiac muscle cell action potential
neuronal action potential
regulation of ventricular cardiac muscle cell membrane repolarization
atrial cardiac muscle cell action potential
membrane depolarization during atrial cardiac muscle cell action potential
cardiac conduction
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)
NM_000335
NM_001099404
NM_001099405
NM_001160160
NM_001160161

NM_198056
NM_001354701

NM_001253860
NM_021544

RefSeq (bjelančevina)
NP_000326
NP_001092874
NP_001092875
NP_001153632
NP_001153633

NP_932173
NP_001341630

NP_001240789
NP_067519

Lokacija (UCSC)Chr 3: 38.55 – 38.65 MbChr 9: 119.31 – 119.41 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

NaV1.5 je podjedinica integralnog membranskog proteina i tetrodotoksin-otporni naponski natrijev kanal. NaV1.5 se prvenstveno nalazi u srčanom mišiću, gdje posreduje u brzom dotoku Na+-iona (INa) preko ćelijske membrane, što rezultira brzom depolarizacijskom fazom srčanog akcijskog potencijala. Kao takav, ima glavnu ulogu u širenju impulsa kroz srce. Veliki broj srčanih bolesti je povezan sa mutacijama u NaV1.5 (vidi paragraf genetika). SCN5A je gen koji kodira srčani natrijski kanal NaV1.5.

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 2.016 aminokiselina, а molekulska težina 226.940 Da.[5]

1020304050
MANFLLPRGTSSFRRFTRESLAAIEKRMAEKQARGSTTLQESREGLPEEE
APRPQLDLQASKKLPDLYGNPPQELIGEPLEDLDPFYSTQKTFIVLNKGK
TIFRFSATNALYVLSPFHPIRRAAVKILVHSLFNMLIMCTILTNCVFMAQ
HDPPPWTKYVEYTFTAIYTFESLVKILARGFCLHAFTFLRDPWNWLDFSV
IIMAYTTEFVDLGNVSALRTFRVLRALKTISVISGLKTIVGALIQSVKKL
ADVMVLTVFCLSVFALIGLQLFMGNLRHKCVRNFTALNGTNGSVEADGLV
WESLDLYLSDPENYLLKNGTSDVLLCGNSSDAGTCPEGYRCLKAGENPDH
GYTSFDSFAWAFLALFRLMTQDCWERLYQQTLRSAGKIYMIFFMLVIFLG
SFYLVNLILAVVAMAYEEQNQATIAETEEKEKRFQEAMEMLKKEHEALTI
RGVDTVSRSSLEMSPLAPVNSHERRSKRRKRMSSGTEECGEDRLPKSDSE
DGPRAMNHLSLTRGLSRTSMKPRSSRGSIFTFRRRDLGSEADFADDENST
AGESESHHTSLLVPWPLRRTSAQGQPSPGTSAPGHALHGKKNSTVDCNGV
VSLLGAGDPEATSPGSHLLRPVMLEHPPDTTTPSEEPGGPQMLTSQAPCV
DGFEEPGARQRALSAVSVLTSALEELEESRHKCPPCWNRLAQRYLIWECC
PLWMSIKQGVKLVVMDPFTDLTITMCIVLNTLFMALEHYNMTSEFEEMLQ
VGNLVFTGIFTAEMTFKIIALDPYYYFQQGWNIFDSIIVILSLMELGLSR
MSNLSVLRSFRLLRVFKLAKSWPTLNTLIKIIGNSVGALGNLTLVLAIIV
FIFAVVGMQLFGKNYSELRDSDSGLLPRWHMMDFFHAFLIIFRILCGEWI
ETMWDCMEVSGQSLCLLVFLLVMVIGNLVVLNLFLALLLSSFSADNLTAP
DEDREMNNLQLALARIQRGLRFVKRTTWDFCCGLLRQRPQKPAALAAQGQ
LPSCIATPYSPPPPETEKVPPTRKETRFEEGEQPGQGTPGDPEPVCVPIA
VAESDTDDQEEDEENSLGTEEESSKQQESQPVSGGPEAPPDSRTWSQVSA
TASSEAEASASQADWRQQWKAEPQAPGCGETPEDSCSEGSTADMTNTAEL
LEQIPDLGQDVKDPEDCFTEGCVRRCPCCAVDTTQAPGKVWWRLRKTCYH
IVEHSWFETFIIFMILLSSGALAFEDIYLEERKTIKVLLEYADKMFTYVF
VLEMLLKWVAYGFKKYFTNAWCWLDFLIVDVSLVSLVANTLGFAEMGPIK
SLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSI
MGVNLFAGKFGRCINQTEGDLPLNYTIVNNKSQCESLNLTGELYWTKVKV
NFDNVGAGYLALLQVATFKGWMDIMYAAVDSRGYEEQPQWEYNLYMYIYF
VIFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQDIFMTEEQKKYYNAMKK
LGSKKPQKPIPRPLNKYQGFIFDIVTKQAFDVTIMFLICLNMVTMMVETD
DQSPEKINILAKINLLFVAIFTGECIVKLAALRHYYFTNSWNIFDFVVVI
LSIVGTVLSDIIQKYFFSPTLFRVIRLARIGRILRLIRGAKGIRTLLFAL
MMSLPALFNIGLLLFLVMFIYSIFGMANFAYVKWEAGIDDMFNFQTFANS
MLCLFQITTSAGWDGLLSPILNTGPPYCDPTLPNSNGSRGDCGSPAVGIL
FFTTYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFDMFYEIWEK
FDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHC
MDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKH
EEVSAMVIQRAFRRHLLQRSLKHASFLFRQQAGSGLSEEDAPEREGLIAY
VMSENFSRPLGPPSSSSISSTSFPPSYDSVTRATSDNLQVRGSDYSHSED
LADFPPSPDRDRESIV

Struktura gena[uredi | uredi izvor]

SCN5A je visoko konzerviran gen[6] koji se nalazi na ljudskom hromosomu 3, gdje se prostire na više od 100 kb. Gen se sastoji od 28 egzona, od kojih egzon 1 i dijelom egzon 2 čine 5' neprevedenu regiju (5' UTR) i egzon 28 3' netranslatiranu regiju RNK (3' UTR). SCN5A je dio porodice od 10 gena koji kodiraju različite tipove natrijumskih kanala, tj. moždane (NaV1.1, NaV1.2, NaV1.3, NaV1.6), neuronske kanale (NaV1.7, NaV1.8 i NaV1.9), kanale skeletnih mišića (NaV1.4) i srčani natrijski kanal NaV1.5.

Ekspresija[uredi | uredi izvor]

SCN5A se uglavnom eksprimira u srcu, gdje je ekspresija obilna u radnom miokardu i provodnom tkivu. Nasuprot tome, ekspresija je niska u sinopretkomorskom i pretkomorskokom čvoru.[7] Unutar srca prisutan je transmuralni gradijent ekspresije od subendokarda do subepikarda, sa većom ekspresijom SCN5A u endokardu u poređenju sa epikardom.[7] SCN5A je takođe izražen u gastrointestinalnom traktu.[8]

Varijante prerade[uredi | uredi izvor]

Više od 10 različitih izoformi prerade opisano je za SCN5A, od kojih nekoliko ima različita funkcionalna svojstva. U srcu su uglavnom izražene dvije izoforme (odnos 1:2), od kojih najmanje dominantna sadrži dodatni glutamin na poziciji 1.077 (1077Q). Štaviše, različite izoforme se eksprimiraju tokom života fetusa i odrasle osobe, a razlikuju se po uključivanju alternativnog egzona 6.[9]

Struktura i funkcija proteina[uredi | uredi izvor]

NaV1.5 je veliki transmembranski protein sa četiri repetitivna transmembranska domena (DI-DIV), koji sadrži po šest transmembranskih sekcija (S1-S6). Područje pora kanala, kroz koje protiču Na+ioni, formirani su segmentima S5 i S6 kod četiri domena. naposka osjetljivost posredovana je preostalim segmentima, od kojih pozitivno nabijeni S4 segmenti imaju osnovnu ulogu.[6][10] NaV1,5 kanali pretežno posreduju natrijsku struju (INa) u srčanim ćelijama. INa je odgovoran za brzo podizanje akcijskog potencijala i kao takav ima ključnu ulogu u širenju impulsa kroz srce. Konformacijsko stanje kanala, koje je ovisno o naponu i vremenu, određuje da li je kanal otvoren ili zatvoren. Na membranskom potencijalu mirovanja (oko -85 mV), NaV1,5 kanali su zatvoreni. Na stimulus (putem provođenja od iz susjedne ćelije), membrana se depolarizira i NaV1,5 kanali se otvaraju kretanjem S4 segmenata prema van, što dovodi do iniciranja akcijskog potencijala. Istovremeno, proces koji se naziva "brza inaktivacija" rezultira zatvaranjem kanala u roku od nekoliko milisekundi. U fiziološkim uslovima, kada su inaktivirani, kanali ostaju u zatvorenom stanju sve dok se ćelijska membrana ne repolarizira, pri čemu je neophodan oporavak od inaktivacije prije nego što ponovo postanu dostupni za aktivaciju. Tokom akcijskog potencijala, perzistira vrlo mali dio natrijeve struje i ne inaktivira se u potpunosti. Ova struja se naziva "trajna struja", "kasna struja" ili "INa,L’.[11][12] Također, neki kanali mogu se reaktivirati tokom faze repolarizacije akcijskog potencijala, na rasponu potencijala gdje inaktivacija nije potpuna i pokazuje preklapanje sa aktivacijom, stvarajući takozvanu „struju prozora“.[13]

Genetika[uredi | uredi izvor]

Mutacije u SCN5A, koje mogu dovesti do gubitka i/ili povećanja funkcije kanala, povezane su sa spektrom srčanih bolesti. Patogene mutacije općenito pokazuju autosomno dominantni obrazac nasljeđivanja, iako su također opisani složeni heterozigotni oblici mutacija SCN5A. Također, mutacije mogu djelovati kao modifikator bolesti, posebno u porodicama u kojima se nedostatak direktne uzročnosti odražava složenim obrascima nasljeđivanja. Važno je napomenuti da značajan broj osoba (2-7%) u općoj populaciji nosi rijetku (populacijsku učestalost) <1%),[14] varijantu koja mijenja protein, naglašavajući složenost povezivanja mutacija direktno s uočenim fenotipovima. Mutacije koje rezultiraju istim biofizičkim efektom mogu dovesti do različitih bolesti.

Do danas su mutacije gubitka funkcije bile povezane sa Brugada sindromom (BrS),[15][16][17] progresivnom bolesti srčane provodljivosti (Lev-Lenègreovm bolesti),[18][19] dilatacijskom kardiomiopatijom (DCM),[20][21] sindromom bolesnih sinusa,[22] i pretkomorskom fibrilacijom.[23]

Mutacije koje rezultiraju povećanjem funkcije su uzrok za sindrom dugog QT-a tip 3[17][24] a također su odnedavno uključeni u multifokusne ektopijske Purkinjeove prevremene kontrakcije (MEPPC)[21][25] Neke mutacije pojačanja funkcije su također povezane sa PF i DCM.[26] Pojačanje funkcije NaV1,5 općenito se odražava povećanjem INa,L, usporenom brzinom inaktivacije ili pomakom u ovisnosti o naponu aktivacije ili inaktivacije (što rezultira povećanom strujom gorepomenutog prozora).

Vjeruje se da se SCN5A mutacije mogu naći kod nesrazmjernog broja ljudi koji imaju sindrom iritabilnog crijeva, posebno varijantu u kojoj preovlađuje zatvor (IBS-C).[8][27] Nastali defekt dovodi do poremećaja u funkciji crijeva, utičući na Nav1.5 kanal, u glatkim mišićima debelog crijeva i ćelijama pejsmejkera.[8] Istraživači su uspjeli izliječiti slučaj IBS-C sa meksiletinom kako bi se obnovili Nav1.5 kanali, poništivši zatvor i bol u trbuhu.[28][29]

Također pogledajte[uredi | uredi izvor]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000183873 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000032511 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "UniProt, Q14524" (jezik: engleski). Pristupljeno 5. 11. 2021.
  6. ^ a b Catterall WA (2014). "Sodium channels, inherited epilepsy, and antiepileptic drugs". Annual Review of Pharmacology and Toxicology. 54: 317–38. doi:10.1146/annurev-pharmtox-011112-140232. PMID 24392695.
  7. ^ a b Remme CA, Verkerk AO, Hoogaars WM, Aanhaanen WT, Scicluna BP, Annink C, van den Hoff MJ, Wilde AA, van Veen TA, Veldkamp MW, de Bakker JM, Christoffels VM, Bezzina CR (Sep 2009). "The cardiac sodium channel displays differential distribution in the conduction system and transmural heterogeneity in the murine ventricular myocardium". Basic Research in Cardiology. 104 (5): 511–22. doi:10.1007/s00395-009-0012-8. PMC 2722719. PMID 19255801.
  8. ^ a b c Beyder A, Farrugia G (2016). "Ion channelopathies in functional GI disorders". American Journal of Physiology. Gastrointestinal and Liver Physiology. 311 (4): G581–G586. doi:10.1152/ajpgi.00237.2016. PMC 5142191. PMID 27514480.
  9. ^ Schroeter A, Walzik S, Blechschmidt S, Haufe V, Benndorf K, Zimmer T (Jul 2010). "Structure and function of splice variants of the cardiac voltage-gated sodium channel Na(v)1.5". Journal of Molecular and Cellular Cardiology. 49 (1): 16–24. doi:10.1016/j.yjmcc.2010.04.004. PMID 20398673.
  10. ^ Chen-Izu Y, Shaw RM, Pitt GS, Yarov-Yarovoy V, Sack JT, Abriel H, Aldrich RW, Belardinelli L, Cannell MB, Catterall WA, Chazin WJ, Chiamvimonvat N, Deschenes I, Grandi E, Hund TJ, Izu LT, Maier LS, Maltsev VA, Marionneau C, Mohler PJ, Rajamani S, Rasmusson RL, Sobie EA, Clancy CE, Bers DM (Mar 2015). "Na+ channel function, regulation, structure, trafficking and sequestration". The Journal of Physiology. 593 (6): 1347–60. doi:10.1113/jphysiol.2014.281428. PMC 4376415. PMID 25772290.
  11. ^ Maltsev VA, Sabbah HN, Higgins RS, Silverman N, Lesch M, Undrovinas AI (Dec 1998). "Novel, ultraslow inactivating sodium current in human ventricular cardiomyocytes". Circulation. 98 (23): 2545–52. doi:10.1161/01.cir.98.23.2545. PMID 9843461.
  12. ^ Sakmann BF, Spindler AJ, Bryant SM, Linz KW, Noble D (Nov 2000). "Distribution of a persistent sodium current across the ventricular wall in guinea pigs". Circulation Research. 87 (10): 910–4. doi:10.1161/01.res.87.10.910. PMID 11073887.
  13. ^ Attwell D, Cohen I, Eisner D, Ohba M, Ojeda C (Mar 1979). "The steady state TTX-sensitive ("window") sodium current in cardiac Purkinje fibres". Pflügers Archiv. 379 (2): 137–42. doi:10.1007/bf00586939. PMID 571107. S2CID 9145214.
  14. ^ Lodder EM, Bezzina CR (Jan 2014). "Genomics of cardiac electrical function". Briefings in Functional Genomics. 13 (1): 39–50. doi:10.1093/bfgp/elt029. PMID 23956259.
  15. ^ Chen Q, Kirsch GE, Zhang D, Brugada R, Brugada J, Brugada P, et al. (Mar 1998). "Genetic basis and molecular mechanism for idiopathic ventricular fibrillation". Nature. 392 (6673): 293–6. Bibcode:1998Natur.392..293C. doi:10.1038/32675. PMID 9521325. S2CID 4315426.
  16. ^ Bezzina C, Veldkamp MW, van Den Berg MP, Postma AV, Rook MB, Viersma JW, van Langen IM, Tan-Sindhunata G, Bink-Boelkens MT, van Der Hout AH, Mannens MM, Wilde AA (Dec 1999). "A single Na(+) channel mutation causing both long-QT and Brugada syndromes". Circulation Research. 85 (12): 1206–13. doi:10.1161/01.res.85.12.1206. PMID 10590249.
  17. ^ a b Remme CA, Verkerk AO, Nuyens D, van Ginneken AC, van Brunschot S, Belterman CN, Wilders R, van Roon MA, Tan HL, Wilde AA, Carmeliet P, de Bakker JM, Veldkamp MW, Bezzina CR (Dec 2006). "Overlap syndrome of cardiac sodium channel disease in mice carrying the equivalent mutation of human SCN5A-1795insD". Circulation. 114 (24): 2584–94. doi:10.1161/CIRCULATIONAHA.106.653949. PMID 17145985.
  18. ^ Schott JJ, Alshinawi C, Kyndt F, Probst V, Hoorntje TM, Hulsbeek M, Wilde AA, Escande D, Mannens MM, Le Marec H (Sep 1999). "Cardiac conduction defects associate with mutations in SCN5A". Nature Genetics. 23 (1): 20–1. doi:10.1038/12618. PMID 10471492. S2CID 7595466.
  19. ^ Tan HL, Bink-Boelkens MT, Bezzina CR, Viswanathan PC, Beaufort-Krol GC, van Tintelen PJ, van den Berg MP, Wilde AA, Balser JR (Feb 2001). "A sodium-channel mutation causes isolated cardiac conduction disease". Nature. 409 (6823): 1043–7. Bibcode:2001Natur.409.1043T. doi:10.1038/35059090. PMID 11234013. S2CID 4422570.
  20. ^ McNair WP, Ku L, Taylor MR, Fain PR, Dao D, Wolfel E, Mestroni L (Oct 2004). "SCN5A mutation associated with dilated cardiomyopathy, conduction disorder, and arrhythmia". Circulation. 110 (15): 2163–7. doi:10.1161/01.CIR.0000144458.58660.BB. PMID 15466643.
  21. ^ a b Laurent G, Saal S, Amarouch MY, Béziau DM, Marsman RF, Faivre L, Barc J, Dina C, Bertaux G, Barthez O, Thauvin-Robinet C, Charron P, Fressart V, Maltret A, Villain E, Baron E, Mérot J, Turpault R, Coudière Y, Charpentier F, Schott JJ, Loussouarn G, Wilde AA, Wolf JE, Baró I, Kyndt F, Probst V (Jul 2012). "Multifocal ectopic Purkinje-related premature contractions: a new SCN5A-related cardiac channelopathy". Journal of the American College of Cardiology. 60 (2): 144–56. doi:10.1016/j.jacc.2012.02.052. PMID 22766342.
  22. ^ Benson DW, Wang DW, Dyment M, Knilans TK, Fish FA, Strieper MJ, Rhodes TH, George AL (Oct 2003). "Congenital sick sinus syndrome caused by recessive mutations in the cardiac sodium channel gene (SCN5A)". The Journal of Clinical Investigation. 112 (7): 1019–28. doi:10.1172/JCI18062. PMC 198523. PMID 14523039.
  23. ^ Makiyama T, Akao M, Shizuta S, Doi T, Nishiyama K, Oka Y, Ohno S, Nishio Y, Tsuji K, Itoh H, Kimura T, Kita T, Horie M (Oct 2008). "A novel SCN5A gain-of-function mutation M1875T associated with familial atrial fibrillation". Journal of the American College of Cardiology. 52 (16): 1326–34. doi:10.1016/j.jacc.2008.07.013. PMID 18929244.
  24. ^ Wang Q, Shen J, Splawski I, Atkinson D, Li Z, Robinson JL, Moss AJ, Towbin JA, Keating MT (Mar 1995). "SCN5A mutations associated with an inherited cardiac arrhythmia, long QT syndrome". Cell. 80 (5): 805–11. doi:10.1016/0092-8674(95)90359-3. PMID 7889574. S2CID 15418443.
  25. ^ Mann SA, Castro ML, Ohanian M, Guo G, Zodgekar P, Sheu A, Stockhammer K, Thompson T, Playford D, Subbiah R, Kuchar D, Aggarwal A, Vandenberg JI, Fatkin D (Oct 2012). "R222Q SCN5A mutation is associated with reversible ventricular ectopy and dilated cardiomyopathy". Journal of the American College of Cardiology. 60 (16): 1566–73. doi:10.1016/j.jacc.2012.05.050. PMID 22999724.
  26. ^ Olson TM, Michels VV, Ballew JD, Reyna SP, Karst ML, Herron KJ, Horton SC, Rodeheffer RJ, Anderson JL (Jan 2005). "Sodium channel mutations and susceptibility to heart failure and atrial fibrillation". JAMA. 293 (4): 447–54. doi:10.1001/jama.293.4.447. PMC 2039897. PMID 15671429.
  27. ^ Verstraelen TE, Ter Bekke RM, Volders PG, Masclee AA, Kruimel JW (2015). "The role of the SCN5A-encoded channelopathy in irritable bowel syndrome and other gastrointestinal disorders". Neurogastroenterology & Motility. 27 (7): 906–13. doi:10.1111/nmo.12569. PMID 25898860. S2CID 5055360.
  28. ^ Beyder A, Mazzone A, Strege PR, Tester DJ, Saito YA, Bernard CE, Enders FT, Ek WE, Schmidt PT, Dlugosz A, Lindberg G, Karling P, Ohlsson B, Gazouli M, Nardone G, Cuomo R, Usai-Satta P, Galeazzi F, Neri M, Portincasa P, Bellini M, Barbara G, Camilleri M, Locke GR, Talley NJ, D'Amato M, Ackerman MJ, Farrugia G (juni 2014). "Loss-of-function of the voltage-gated sodium channel NaV1.5 (channelopathies) in patients with irritable bowel syndrome". Gastroenterology. 146 (7): 1659–68. doi:10.1053/j.gastro.2014.02.054. PMC 4096335. PMID 24613995.
  29. ^ Beyder A, Strege PR, Bernard CE, Mazzone A, Tester DJ, Saito YA, Camilleri M, Locke GR, Talley NJ (1. 9. 2013). "Mexiletine rescues dysfunction of the Nav1.5 mutation A997t and restores bowel function in a patient with irritable bowel syndrome (ibs)". Neurogastroenterology & Motility (jezik: ENGLISH). 25. ISSN 1350-1925.CS1 održavanje: nepoznati jezik (link)

Dopunska literatutra[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]