Idi na sadržaj

PTPN11

S Wikipedije, slobodne enciklopedije
(Preusmjereno sa SHP-2)
PTPN11
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2SHP, 3B7O, 3MOW, 3O5X, 3TKZ, 3TL0, 4DGP, 4DGX, 4GWF, 4H1O, 4JE4, 4JEG, 3ZM0, 3ZM1, 3ZM2, 3ZM3, 4H34, 4JMG, 4NWF, 4NWG, 4OHD, 4OHE, 4OHH, 4OHI, 4OHL, 4PVG, 4RDD, 4QSY, 5DF6, 5IBS, 5EHP, 5EHR, 5I6V, 5IBM

Identifikatori
AliasiPTPN11
Vanjski ID-jeviOMIM: 176876 MGI: 99511 HomoloGene: 2122 GeneCards: PTPN11
Lokacija gena (čovjek)
Hromosom 12 (čovjek)
Hrom.Hromosom 12 (čovjek)[1]
Hromosom 12 (čovjek)
Genomska lokacija za PTPN11
Genomska lokacija za PTPN11
Bend12q24.13Početak112,418,351 bp[1]
Kraj112,509,918 bp[1]
Lokacija gena (miš)
Hromosom 5 (miš)
Hrom.Hromosom 5 (miš)[2]
Hromosom 5 (miš)
Genomska lokacija za PTPN11
Genomska lokacija za PTPN11
Bend5|5 FPočetak121,268,596 bp[2]
Kraj121,329,460 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija phospholipase binding
phosphoprotein phosphatase activity
insulin receptor binding
GO:0098519, GO:0098518 phosphatase activity
receptor tyrosine kinase binding
peptide hormone receptor binding
GO:0001948, GO:0016582 vezivanje za proteine
non-membrane spanning protein tyrosine phosphatase activity
hydrolase activity
phosphatidylinositol-4,5-bisphosphate 3-kinase activity
1-phosphatidylinositol-3-kinase activity
cell adhesion molecule binding
protein tyrosine phosphatase activity
phosphotyrosine residue binding
protein domain specific binding
D1 dopamine receptor binding
insulin receptor substrate binding
protein tyrosine kinase binding
protein kinase binding
Ćelijska komponenta citoplazma
citosol
mitohondrija
jedro
nukleoplazma
GO:0009327 makromolekulani kompleks
Biološki proces GO:0098501, GO:0098502, GO:0006286 Defosforilacija
megakaryocyte development
positive regulation of signal transduction
negative regulation of insulin secretion
regulation of cell adhesion mediated by integrin
atrioventricular canal development
intestinal epithelial cell migration
organ growth
epidermal growth factor receptor signaling pathway
negative regulation of growth hormone secretion
axonogenesis
glucose homeostasis
regulation of protein export from nucleus
multicellular organism growth
regulation of multicellular organism growth
lipid metabolism
ephrin receptor signaling pathway
abortive mitotic cell cycle
DNA damage checkpoint signaling
GO:0016576 protein dephosphorylation
T cell costimulation
platelet formation
microvillus organization
positive regulation of mitotic cell cycle
genitalia development
platelet activation
fibroblast growth factor receptor signaling pathway
development of the heart
brain development
regulation of type I interferon-mediated signaling pathway
hormone-mediated signaling pathway
integrin-mediated signaling pathway
Bergmann glial cell differentiation
homeostasis of number of cells within a tissue
inner ear development
platelet-derived growth factor receptor signaling pathway
negative regulation of cortisol secretion
peptidyl-tyrosine dephosphorylation
ERBB signaling pathway
negative regulation of hormone secretion
triglyceride metabolic process
hormone metabolic process
positive regulation of hormone secretion
negative regulation of cell adhesion mediated by integrin
GO:0106159 regulation of protein-containing complex assembly
face morphogenesis
cerebellar cortex formation
leukocyte migration
multicellular organismal reproductive process
phosphatidylinositol phosphate biosynthetic process
neurotrophin TRK receptor signaling pathway
phosphatidylinositol-3-phosphate biosynthetic process
axon guidance
positive regulation of ERK1 and ERK2 cascade
cellular response to epidermal growth factor stimulus
positive regulation of protein kinase B signaling
cytokine-mediated signaling pathway
interleukin-6-mediated signaling pathway
cellular response to cytokine stimulus
cellular response to mechanical stimulus
positive regulation of interferon-beta production
positive regulation of interleukin-6 production
positive regulation of tumor necrosis factor production
positive regulation of glucose import
GO:1903106 positive regulation of insulin receptor signaling pathway
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_002834
NM_080601
NM_001330437
NM_001374625
NM_018508

NM_001109992
NM_011202

RefSeq (bjelančevina)

NP_001317366
NP_002825
NP_542168
NP_001361554

NP_001103462
NP_035332

Lokacija (UCSC)Chr 12: 112.42 – 112.51 MbChr 5: 121.27 – 121.33 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Tirozin-nereceptorski fosfatazni protein tip 11 (PTPN11), znan i kao protein-tirozinska fosfataza 1D (PTP-1D), Src homologijska regija 2 sa domenom fosfataze-2 (SHP-2) ili protein-tirozin fosfataza 2C (PTP-2C) je enzim koji je klod ljudi kodiran]g [genom PTPN11. PTPN11 je proteinska tirozin-fosfataza (PTP) Shp2.[5][6]

PTPN11 je član porodice proteinskih tirozin-fosfataza (PTP). Poznato PTP signalne molekule reguliraju različite ćelijske procese, uključujući ćelijski rastra, diferencijaciju, mitotski ciklus i onkogenu transformaciju. Ovaj PTP sadrži dva tandem Src homologijske-2 domena, koji funkcioniraju kao domeni za vezanje fosfo-tirozina i posreduju u interakciji ovog PTP-a sa supstratima. Široko eksprimiran u većini tkiva i ima regulatornu ulogu u raznim ćelijskim signalnim događajima, koji su važni za različite ćelijske funkcije, poput mitogene aktivacije, metaboličke kontrole, regulacije transkripcije i migracije ćelija. Mutacije u ovom genu su uzrok Noonanovog sindroma, kao i akutne mijeloidne leukemije.[7]

Aminokiselinska sekvenca

[uredi | uredi izvor]

Dužina polipeptidnog lanca je 597 aminokiselina, a molekulska težina 68.436 Da.[8]

1020304050
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGA
VTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKY
PLNCADPTSERWFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLS
VRTGDDKGESNDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKN
PMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETTDKVKQGFWEE
FETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENS
RVIVMTTKEVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRE
LKLSKVGQALLQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQ
ESIMDAGPVVVHCSAGIGRTGTFIVIDILIDIIREKGVDCDIDVPKTIQM
VRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGHEYTNIK
YSLADQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQKSFR
Simboli

Struktura i funkcija

[uredi | uredi izvor]

Ova fosfataza, zajedno sa svojim paralogom, Shp1, ima domensku strukturu koja se sastoji od dva tandemska SH2 domena u N-kraju, praćena domenom proteinske tirozin-fosfataze (PTP). U neaktivnom stanju, N2-terminalni SH2 domen veže PTP domen i blokira pristup potencijalnih podloga aktivnom mjestu. Dakle, Shp2 se automatski inhibira.

Nakon vezivanja za ciljne fosfo-tirozilne ostatke, N-terminalni SH2 domen oslobađa se iz PTP domena, katalitski aktivirajući enzim, oslobađanjem od ove auto-inhibicije.

Nasljedne bolesti povezane sa PTPN11

[uredi | uredi izvor]

Misense mutacije u lokusu PTPN11 povezane su sa Noonnovim i Leopardovim sindromom.

Također je povezan sa metahondromatozom.[9]

Noonanov sindrom

[uredi | uredi izvor]

U slučaju Noonanovog sindroma, mutacije su široko raspoređene po kodirajućoj regiji gena, ali čini se da sve rezultiraju hiperaktiviranim ili nereguliranim mutantnim oblicima proteina. Većina ovih mutacija remeti vezujući interfejsa između domena N-SH2 i katalitifskog jezgra neophodnog da bi enzim održao autoinhibiranu konformaciju.[10]

Leopardov sindrom

[uredi | uredi izvor]

Mutacije koje uzrokuju Leopardov sindrom ograničene su regije koje utiču na katalitsko jezgro enzima za proizvodnju katalitski oštećene varijante Shp2.[11] Još nije jasno kako mutacije koje uzrokuju mutantne varijante Shp2 s biohemijski suprotnim karakteristikama rezultiraju sličnim ljudskim genetičkim sindromima.

Kancer povezan sa PTPN11

[uredi | uredi izvor]

Pacijenti sa podskupinom mutacija PTPN11 Noonanovog sindroma također imaju veću prevalenciju juvenilne mijelomonocitne leukemije s (JMML). Aktivirajuće mutacije Shp2 također su otkrivene u neuroblastomu, melanomu, akutnoj mijeloidnoj leukemiji, raku dojke, pluća i kolorektumskom karcinomu.[12] Nedavno je otkrivena relativno velika prevalencija PTPN11 mutacija (24%) sljedećom generacijom sekvenciranja u kohorti mutiranih pacijenata NPM1akutna mijeloidna leukemija,[13] iako prognostički značaj takvih pridruživanja nije razjašnjen. Ovi podaci ukazuju na to da bi Shp2 mogao biti protoonkogen. Međutim, prijavljeno je da PTPN11/Shp2 može djelovati ili kao tumorski promotor ili supresor.[14] U starijem mišjem modelu, delecija PTPN11 / Shp2 specifična za hepatocite podstiče upalnu signalizaciju putem STAT3 i upale jetre /nekroze, što rezultira regenerativnom hiperplazijom i spontanim razvojem tumora. Smanjena ekspresija PTPN11 / Shp2 otkrivena je u potfrakciji ljudskim hepatoćelijskim karcinomma (HCC).[14] Bakterija Helicobacter pylori povezana je s rakom želuca, a smatra se da je to djelomično posredovano interakcijom njenog faktora virulencije CagA s SHP2.[15]

H faktor virulencije Pylori CagA

[uredi | uredi izvor]

CagA je protein i faktor virulencije insertiran iz Helicobacter pylori u epitel želuca. Fosforilacijom aktivirani SRC, CagA veže se za SHP2, alosterino ga aktivirajući. To dovodi do morfoloških promjena, abnormalniih mitogenih signala i trajne aktivnosti, što može rezultirati apoptozom ćelijee domaćina.

Epidemiološke studije pokazale su ulogu cagA-pozitivnog H. pylori u razvoju atrofijskog gastritisa, čira na želucu bolesti i karcinom želuca.[16]

Interakcije

[uredi | uredi izvor]

Pokazalo se da PTPN11 ima interakcije sa

Reference

[uredi | uredi izvor]
  1. 1 2 3 GRCh38: Ensembl release 89: ENSG00000179295 - Ensembl, maj 2017
  2. 1 2 3 GRCm38: Ensembl release 89: ENSMUSG00000043733 - Ensembl, maj 2017
  3. "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. Jamieson CR, van der Burgt I, Brady AF, van Reen M, Elsawi MM, Hol F, Jeffery S, Patton MA, Mariman E (decembar 1994). "Mapping a gene for Noonan syndrome to the long arm of chromosome 12". Nat. Genet. 8 (4): 357–60. doi:10.1038/ng1294-357. PMID 7894486. S2CID 1582162.
  6. Freeman RM, Plutzky J, Neel BG (decembar 1992). "Identification of a human Src homology 2-containing protein-tyrosine-phosphatase: a putative homolog of Drosophila corkscrew". Proc. Natl. Acad. Sci. U.S.A. 89 (23): 11239–43. doi:10.1073/pnas.89.23.11239. PMC 50525. PMID 1280823.
  7. "Entrez Gene: PTPN11 protein tyrosine phosphatase, non-receptor type 11 (Noonan syndrome 1)".
  8. "UniProt, Q06124". Pristupljeno 13. 8. 2021.
  9. Sobreira NL, Cirulli ET, Avramopoulos D, Wohler E, Oswald GL, Stevens EL, Ge D, Shianna KV, Smith JP, Maia JM, Gumbs CE, Pevsner J, Thomas G, Valle D, Hoover-Fong JE, Goldstein DB (juni 2010). "Whole-genome sequencing of a single proband together with linkage analysis identifies a Mendelian disease gene". PLOS Genet. 6 (6): e1000991. doi:10.1371/journal.pgen.1000991. PMC 2887469. PMID 20577567.
  10. Roberts AE, Araki T, Swanson KD, Montgomery KT, Schiripo TA, Joshi VA, Li L, Yassin Y, Tamburino AM, Neel BG, Kucherlapati RS (januar 2007). "Germline gain-of-function mutations in SOS1 cause Noonan syndrome". Nat. Genet. 39 (1): 70–4. doi:10.1038/ng1926. PMID 17143285. S2CID 10222262.
  11. Kontaridis MI, Swanson KD, David FS, Barford D, Neel BG (mart 2006). "PTPN11 (Shp2) mutations in LEOPARD syndrome have dominant negative, not activating, effects". J. Biol. Chem. 281 (10): 6785–92. doi:10.1074/jbc.M513068200. PMID 16377799.
  12. Bentires-Alj M, Paez JG, David FS, Keilhack H, Halmos B, Naoki K, Maris JM, Richardson A, Bardelli A, Sugarbaker DJ, Richards WG, Du J, Girard L, Minna JD, Loh ML, Fisher DE, Velculescu VE, Vogelstein B, Meyerson M, Sellers WR, Neel BG (decembar 2004). "Activating mutations of the noonan syndrome-associated SHP2/PTPN11 gene in human solid tumors and adult acute myelogenous leukemia". Cancer Res. 64 (24): 8816–20. doi:10.1158/0008-5472.CAN-04-1923. PMID 15604238.
  13. Patel SS, Kuo FC, Gibson CJ, Steensma DP, Soiffer RJ, Alyea EP, Chen YA, Fathi AT, Graubert TA, Brunner AM, Wadleigh M, Stone RM, DeAngelo DJ, Nardi V, Hasserjian RP, Weinberg OK (maj 2018). "High NPM1 mutant allele burden at diagnosis predicts unfavorable outcomes in de novo AML". Blood. 131 (25): 2816–2825. doi:10.1182/blood-2018-01-828467. PMC 6265642. PMID 29724895.
  14. 1 2 3 Bard-Chapeau EA, Li S, Ding J, Zhang SS, Zhu HH, Princen F, Fang DD, Han T, Bailly-Maitre B, Poli V, Varki NM, Wang H, Feng GS (maj 2011). "Ptpn11/Shp2 acts as a tumor suppressor in hepatocellular carcinogenesis". Cancer Cell. 19 (5): 629–39. doi:10.1016/j.ccr.2011.03.023. PMC 3098128. PMID 21575863.
  15. 1 2 Hatakeyama M, Higashi H (2005). "Helicobacter pylori CagA: a new paradigm for bacterial carcinogenesis". Cancer Science. 96 (12): 835–843. doi:10.1111/j.1349-7006.2005.00130.x. PMID 16367902. S2CID 5721063.
  16. Hatakeyama M (septembar 2004). "Oncogenic mechanisms of the Helicobacter pylori CagA protein". Nature Reviews Cancer. 4 (9): 688–94. doi:10.1038/nrc1433. PMID 15343275. S2CID 1218835.
  17. Tanaka Y, Tanaka N, Saeki Y, Tanaka K, Murakami M, Hirano T, Ishii N, Sugamura K (Aug 2008). "c-Cbl-dependent monoubiquitination and lysosomal degradation of gp130". Mol. Cell. Biol. 28 (15): 4805–18. doi:10.1128/MCB.01784-07. PMC 2493370. PMID 18519587.
  18. Tauchi T, Feng GS, Marshall MS, Shen R, Mantel C, Pawson T, Broxmeyer HE (oktobar 1994). "The ubiquitously expressed Syp phosphatase interacts with c-kit and Grb2 in hematopoietic cells". J. Biol. Chem. 269 (40): 25206–11. PMID 7523381.
  19. Kozlowski M, Larose L, Lee F, Le DM, Rottapel R, Siminovitch KA (april 1998). "SHP-1 binds and negatively modulates the c-Kit receptor by interaction with tyrosine 569 in the c-Kit juxtamembrane domain". Mol. Cell. Biol. 18 (4): 2089–99. doi:10.1128/MCB.18.4.2089. PMC 121439. PMID 9528781.
  20. Ilan N, Cheung L, Pinter E, Madri JA (juli 2000). "Platelet-endothelial cell adhesion molecule-1 (CD31), a scaffolding molecule for selected catenin family members whose binding is mediated by different tyrosine and serine/threonine phosphorylation". J. Biol. Chem. 275 (28): 21435–43. doi:10.1074/jbc.M001857200. PMID 10801826.
  21. Pumphrey NJ, Taylor V, Freeman S, Douglas MR, Bradfield PF, Young SP, Lord JM, Wakelam MJ, Bird IN, Salmon M, Buckley CD (april 1999). "Differential association of cytoplasmic signalling molecules SHP-1, SHP-2, SHIP and phospholipase C-gamma1 with PECAM-1/CD31". FEBS Lett. 450 (1–2): 77–83. doi:10.1016/S0014-5793(99)00446-9. PMID 10350061. S2CID 31471121.
  22. Hua CT, Gamble JR, Vadas MA, Jackson DE (oktobar 1998). "Recruitment and activation of SHP-1 protein-tyrosine phosphatase by human platelet endothelial cell adhesion molecule-1 (PECAM-1). Identification of immunoreceptor tyrosine-based inhibitory motif-like binding motifs and substrates". J. Biol. Chem. 273 (43): 28332–40. doi:10.1074/jbc.273.43.28332. PMID 9774457.
  23. Jackson DE, Ward CM, Wang R, Newman PJ (mart 1997). "The protein-tyrosine phosphatase SHP-2 binds platelet/endothelial cell adhesion molecule-1 (PECAM-1) and forms a distinct signaling complex during platelet aggregation. Evidence for a mechanistic link between PECAM-1- and integrin-mediated cellular signaling". J. Biol. Chem. 272 (11): 6986–93. doi:10.1074/jbc.272.11.6986. PMID 9054388.
  24. Huber M, Izzi L, Grondin P, Houde C, Kunath T, Veillette A, Beauchemin N (Jan 1999). "The carboxyl-terminal region of biliary glycoprotein controls its tyrosine phosphorylation and association with protein-tyrosine phosphatases SHP-1 and SHP-2 in epithelial cells". J. Biol. Chem. 274 (1): 335–44. doi:10.1074/jbc.274.1.335. PMID 9867848.
  25. Schulze WX, Deng L, Mann M (2005). "Phosphotyrosine interactome of the ErbB-receptor kinase family". Mol. Syst. Biol. 1 (1): E1–E13. doi:10.1038/msb4100012. PMC 1681463. PMID 16729043.
  26. Tomic S, Greiser U, Lammers R, Kharitonenkov A, Imyanitov E, Ullrich A, Böhmer FD (Sep 1995). "Association of SH2 domain protein tyrosine phosphatases with the epidermal growth factor receptor in human tumor cells. Phosphatidic acid activates receptor dephosphorylation by PTP1C". J. Biol. Chem. 270 (36): 21277–84. doi:10.1074/jbc.270.36.21277. PMID 7673163.
  27. 1 2 3 L.A. Lai; C. Zhao; E.E. Zhang; G.S. Feng (2004). "14 The Shp-2 tyrosine phosphatase". u Joaquín Ariño; Denis Alexander (ured.). Protein phosphatases. Springer. str. 275–299. ISBN 978-3-540-20560-9.
  28. 1 2 Neel BG, Gu H, Pao L (juni 2003). "The 'Shp'ing news: SH2 domain-containing tyrosine phosphatases in cell signaling". Trends in Biochemical Sciences. 28 (6): 284–293. doi:10.1016/S0968-0004(03)00091-4. ISSN 0968-0004. PMID 12826400.
  29. Delahaye L, Rocchi S, Van Obberghen E (Feb 2000). "Potential involvement of FRS2 in insulin signaling". Endocrinology. 141 (2): 621–8. doi:10.1210/endo.141.2.7298. PMID 10650943.
  30. Kurokawa K, Iwashita T, Murakami H, Hayashi H, Kawai K, Takahashi M (Apr 2001). "Identification of SNT/FRS2 docking site on RET receptor tyrosine kinase and its role for signal transduction". Oncogene. 20 (16): 1929–38. doi:10.1038/sj.onc.1204290. PMID 11360177.
  31. 1 2 3 Hadari YR, Kouhara H, Lax I, Schlessinger J (Jul 1998). "Binding of Shp2 tyrosine phosphatase to FRS2 is essential for fibroblast growth factor-induced PC12 cell differentiation". Mol. Cell. Biol. 18 (7): 3966–73. doi:10.1128/MCB.18.7.3966. PMC 108981. PMID 9632781.
  32. Saito Y, Hojo Y, Tanimoto T, Abe J, Berk BC (Jun 2002). "Protein kinase C-alpha and protein kinase C-epsilon are required for Grb2-associated binder-1 tyrosine phosphorylation in response to platelet-derived growth factor". J. Biol. Chem. 277 (26): 23216–22. doi:10.1074/jbc.M200605200. PMID 11940581.
  33. Rocchi S, Tartare-Deckert S, Murdaca J, Holgado-Madruga M, Wong AJ, Van Obberghen E (Jul 1998). "Determination of Gab1 (Grb2-associated binder-1) interaction with insulin receptor-signaling molecules". Mol. Endocrinol. 12 (7): 914–23. doi:10.1210/mend.12.7.0141. PMID 9658397.
  34. 1 2 Boudot C, Kadri Z, Petitfrère E, Lambert E, Chrétien S, Mayeux P, Haye B, Billat C (oktobar 2002). "Phosphatidylinositol 3-kinase regulates glycosylphosphatidylinositol hydrolysis through PLC-gamma(2) activation in erythropoietin-stimulated cells". Cell. Signal. 14 (10): 869–78. doi:10.1016/S0898-6568(02)00036-0. PMID 12135708.
  35. Lynch DK, Daly RJ (januar 2002). "PKB-mediated negative feedback tightly regulates mitogenic signalling via Gab2". EMBO J. 21 (1–2): 72–82. doi:10.1093/emboj/21.1.72. PMC 125816. PMID 11782427.
  36. Zhao C, Yu DH, Shen R, Feng GS (juli 1999). "Gab2, a new pleckstrin homology domain-containing adapter protein, acts to uncouple signaling from ERK kinase to Elk-1". J. Biol. Chem. 274 (28): 19649–54. doi:10.1074/jbc.274.28.19649. PMID 10391903.
  37. Crouin C, Arnaud M, Gesbert F, Camonis J, Bertoglio J (april 2001). "A yeast two-hybrid study of human p97/Gab2 interactions with its SH2 domain-containing binding partners". FEBS Lett. 495 (3): 148–53. doi:10.1016/S0014-5793(01)02373-0. PMID 11334882. S2CID 24499468.
  38. Wolf, I.; Jenkins, B. J.; Liu, Y.; Seiffert, M.; Custodio, J. M.; Young, P.; Rohrschneider, L. R. (2002). "Gab3, a New DOS/Gab Family Member, Facilitates Macrophage Differentiation". Molecular and Cellular Biology. 22 (1): 231–244. doi:10.1128/MCB.22.1.231-244.2002. ISSN 0270-7306. PMC 134230. PMID 11739737. and associates transiently with the SH2 domain-containing proteins p85 and SHP2
  39. 1 2 3 Lehmann U, Schmitz J, Weissenbach M, Sobota RM, Hortner M, Friederichs K, Behrmann I, Tsiaris W, Sasaki A, Schneider-Mergener J, Yoshimura A, Neel BG, Heinrich PC, Schaper F (januar 2003). "SHP2 and SOCS3 contribute to Tyr-759-dependent attenuation of interleukin-6 signaling through gp130". J. Biol. Chem. 278 (1): 661–71. doi:10.1074/jbc.M210552200. PMID 12403768.
  40. Anhuf D, Weissenbach M, Schmitz J, Sobota R, Hermanns HM, Radtke S, Linnemann S, Behrmann I, Heinrich PC, Schaper F (Sep 2000). "Signal transduction of IL-6, leukemia-inhibitory factor, and oncostatin M: structural receptor requirements for signal attenuation". Journal of Immunology. 165 (5): 2535–43. doi:10.4049/jimmunol.165.5.2535. PMID 10946280.
  41. Kim H, Baumann H (Dec 1997). "Transmembrane domain of gp130 contributes to intracellular signal transduction in hepatic cells". J. Biol. Chem. 272 (49): 30741–7. doi:10.1074/jbc.272.49.30741. PMID 9388212.
  42. 1 2 3 Yin T, Shen R, Feng GS, Yang YC (januar 1997). "Molecular characterization of specific interactions between SHP-2 phosphatase and JAK tyrosine kinases". J. Biol. Chem. 272 (2): 1032–7. doi:10.1074/jbc.272.2.1032. PMID 8995399.
  43. Ganju RK, Brubaker SA, Chernock RD, Avraham S, Groopman JE (Jun 2000). "Beta-chemokine receptor CCR5 signals through SHP1, SHP2, and Syk". J. Biol. Chem. 275 (23): 17263–8. doi:10.1074/jbc.M000689200. PMID 10747947.
  44. Bennett AM, Tang TL, Sugimoto S, Walsh CT, Neel BG (Jul 1994). "Protein-tyrosine-phosphatase SHPTP2 couples platelet-derived growth factor receptor beta to Ras". Proc. Natl. Acad. Sci. U.S.A. 91 (15): 7335–9. doi:10.1073/pnas.91.15.7335. PMC 44394. PMID 8041791.
  45. Ward AC, Monkhouse JL, Hamilton JA, Csar XF (Nov 1998). "Direct binding of Shc, Grb2, SHP-2 and p40 to the murine granulocyte colony-stimulating factor receptor". Biochim. Biophys. Acta. 1448 (1): 70–6. doi:10.1016/S0167-4889(98)00120-7. PMID 9824671.
  46. Tang J, Feng GS, Li W (Oct 1997). "Induced direct binding of the adapter protein Nck to the GTPase-activating protein-associated protein p62 by epidermal growth factor". Oncogene. 15 (15): 1823–32. doi:10.1038/sj.onc.1201351. PMID 9362449.
  47. Tang H, Zhao ZJ, Huang XY, Landon EJ, Inagami T (Apr 1999). "Fyn kinase-directed activation of SH2 domain-containing protein-tyrosine phosphatase SHP-2 by Gi protein-coupled receptors in Madin-Darby canine kidney cells". J. Biol. Chem. 274 (18): 12401–7. doi:10.1074/jbc.274.18.12401. PMID 10212213.
  48. Zhang S, Mantel C, Broxmeyer HE (Mar 1999). "Flt3 signaling involves tyrosyl-phosphorylation of SHP-2 and SHIP and their association with Grb2 and Shc in Baf3/Flt3 cells". J. Leukoc. Biol. 65 (3): 372–80. doi:10.1002/jlb.65.3.372. PMID 10080542. S2CID 38211235.
  49. Wong L, Johnson GR (Aug 1996). "Epidermal growth factor induces coupling of protein-tyrosine phosphatase 1D to GRB2 via the COOH-terminal SH3 domain of GRB2". J. Biol. Chem. 271 (35): 20981–4. doi:10.1074/jbc.271.35.20981. PMID 8702859.
  50. Stofega MR, Herrington J, Billestrup N, Carter-Su C (septembar 2000). "Mutation of the SHP-2 binding site in growth hormone (GH) receptor prolongs GH-promoted tyrosyl phosphorylation of GH receptor, JAK2, and STAT5B". Mol. Endocrinol. 14 (9): 1338–50. doi:10.1210/me.14.9.1338. PMID 10976913.
  51. Moutoussamy S, Renaudie F, Lago F, Kelly PA, Finidori J (juni 1998). "Grb10 identified as a potential regulator of growth hormone (GH) signaling by cloning of GH receptor target proteins". J. Biol. Chem. 273 (26): 15906–12. doi:10.1074/jbc.273.26.15906. PMID 9632636.
  52. Wang H, Lindsey S, Konieczna I, Bei L, Horvath E, Huang W, Saberwal G, Eklund EA (Jan 2009). "Constitutively active SHP2 cooperates with HoxA10 overexpression to induce acute myeloid leukemia". J Biol Chem. 284 (4): 2549–67. doi:10.1074/jbc.M804704200. PMC 2629090. PMID 19022774.
  53. Maegawa H, Ugi S, Adachi M, Hinoda Y, Kikkawa R, Yachi A, Shigeta Y, Kashiwagi A (Mar 1994). "Insulin receptor kinase phosphorylates protein tyrosine phosphatase containing Src homology 2 regions and modulates its PTPase activity in vitro". Biochem. Biophys. Res. Commun. 199 (2): 780–5. doi:10.1006/bbrc.1994.1297. PMID 8135823.
  54. Kharitonenkov A, Schnekenburger J, Chen Z, Knyazev P, Ali S, Zwick E, White M, Ullrich A (Dec 1995). "Adapter function of protein-tyrosine phosphatase 1D in insulin receptor/insulin receptor substrate-1 interaction". J. Biol. Chem. 270 (49): 29189–93. doi:10.1074/jbc.270.49.29189. PMID 7493946.
  55. Mañes S, Mira E, Gómez-Mouton C, Zhao ZJ, Lacalle RA, Martínez-A C (Apr 1999). "Concerted activity of tyrosine phosphatase SHP-2 and focal adhesion kinase in regulation of cell motility". Mol. Cell. Biol. 19 (4): 3125–35. doi:10.1128/mcb.19.4.3125. PMC 84106. PMID 10082579.
  56. Seely BL, Reichart DR, Staubs PA, Jhun BH, Hsu D, Maegawa H, Milarski KL, Saltiel AR, Olefsky JM (Aug 1995). "Localization of the insulin-like growth factor I receptor binding sites for the SH2 domain proteins p85, Syp, and GTPase activating protein". J. Biol. Chem. 270 (32): 19151–7. doi:10.1074/jbc.270.32.19151. PMID 7642582.
  57. Kuhné MR, Pawson T, Lienhard GE, Feng GS (Jun 1993). "The insulin receptor substrate 1 associates with the SH2-containing phosphotyrosine phosphatase Syp". J. Biol. Chem. 268 (16): 11479–81. PMID 8505282.
  58. Myers MG, Mendez R, Shi P, Pierce JH, Rhoads R, White MF (Oct 1998). "The COOH-terminal tyrosine phosphorylation sites on IRS-1 bind SHP-2 and negatively regulate insulin signaling". J. Biol. Chem. 273 (41): 26908–14. doi:10.1074/jbc.273.41.26908. PMID 9756938.
  59. Tauchi T, Damen JE, Toyama K, Feng GS, Broxmeyer HE, Krystal G (juni 1996). "Tyrosine 425 within the activated erythropoietin receptor binds Syp, reduces the erythropoietin required for Syp tyrosine phosphorylation, and promotes mitogenesis". Blood. 87 (11): 4495–501. doi:10.1182/blood.V87.11.4495.bloodjournal87114495. PMID 8639815.
  60. Maegawa H, Kashiwagi A, Fujita T, Ugi S, Hasegawa M, Obata T, Nishio Y, Kojima H, Hidaka H, Kikkawa R (novembar 1996). "SHPTP2 serves adapter protein linking between Janus kinase 2 and insulin receptor substrates". Biochem. Biophys. Res. Commun. 228 (1): 122–7. doi:10.1006/bbrc.1996.1626. PMID 8912646.
  61. Fournier N, Chalus L, Durand I, Garcia E, Pin JJ, Churakova T, Patel S, Zlot C, Gorman D, Zurawski S, Abrams J, Bates EE, Garrone P (Aug 2000). "FDF03, a novel inhibitory receptor of the immunoglobulin superfamily, is expressed by human dendritic and myeloid cells". Journal of Immunology. 165 (3): 1197–209. doi:10.4049/jimmunol.165.3.1197. PMID 10903717.
  62. Meyaard L, Adema GJ, Chang C, Woollatt E, Sutherland GR, Lanier LL, Phillips JH (Aug 1997). "LAIR-1, a novel inhibitory receptor expressed on human mononuclear leukocytes". Immunity. 7 (2): 283–90. doi:10.1016/S1074-7613(00)80530-0. PMID 9285412.
  63. Betts GN, van der Geer P, Komives EA (juni 2008). "Structural and functional consequences of tyrosine phosphorylation in the LRP1 cytoplasmic domain". J. Biol. Chem. 283 (23): 15656–64. doi:10.1074/jbc.M709514200. PMC 2414285. PMID 18381291.
  64. Keilhack H, Müller M, Böhmer SA, Frank C, Weidner KM, Birchmeier W, Ligensa T, Berndt A, Kosmehl H, Günther B, Müller T, Birchmeier C, Böhmer FD (Jan 2001). "Negative regulation of Ros receptor tyrosine kinase signaling. An epithelial function of the SH2 domain protein tyrosine phosphatase SHP-1". J. Cell Biol. 152 (2): 325–34. doi:10.1083/jcb.152.2.325. PMC 2199605. PMID 11266449.
  65. Lechleider RJ, Sugimoto S, Bennett AM, Kashishian AS, Cooper JA, Shoelson SE, Walsh CT, Neel BG (Oct 1993). "Activation of the SH2-containing phosphotyrosine phosphatase SH-PTP2 by its binding site, phosphotyrosine 1009, on the human platelet-derived growth factor receptor". J. Biol. Chem. 268 (29): 21478–81. PMID 7691811.
  66. Chauhan D, Pandey P, Hideshima T, Treon S, Raje N, Davies FE, Shima Y, Tai YT, Rosen S, Avraham S, Kharbanda S, Anderson KC (septembar 2000). "SHP2 mediates the protective effect of interleukin-6 against dexamethasone-induced apoptosis in multiple myeloma cells". J. Biol. Chem. 275 (36): 27845–50. doi:10.1074/jbc.M003428200. PMID 10880513.
  67. Howie D, Simarro M, Sayos J, Guirado M, Sancho J, Terhorst C (Feb 2000). "Molecular dissection of the signaling and costimulatory functions of CD150 (SLAM): CD150/SAP binding and CD150-mediated costimulation". Blood. 99 (3): 957–65. doi:10.1182/blood.V99.3.957. PMID 11806999.
  68. Morra M, Lu J, Poy F, Martin M, Sayos J, Calpe S, Gullo C, Howie D, Rietdijk S, Thompson A, Coyle AJ, Denny C, Yaffe MB, Engel P, Eck MJ, Terhorst C (Nov 2001). "Structural basis for the interaction of the free SH2 domain EAT-2 with SLAM receptors in hematopoietic cells". EMBO J. 20 (21): 5840–52. doi:10.1093/emboj/20.21.5840. PMC 125701. PMID 11689425.
  69. Chin H, Saito T, Arai A, Yamamoto K, Kamiyama R, Miyasaka N, Miura O (Oct 1997). "Erythropoietin and IL-3 induce tyrosine phosphorylation of CrkL and its association with Shc, SHP-2, and Cbl in hematopoietic cells". Biochem. Biophys. Res. Commun. 239 (2): 412–7. doi:10.1006/bbrc.1997.7480. PMID 9344843.
  70. 1 2 Yu CL, Jin YJ, Burakoff SJ (Jan 2000). "Cytosolic tyrosine dephosphorylation of STAT5. Potential role of SHP-2 in STAT5 regulation". J. Biol. Chem. 275 (1): 599–604. doi:10.1074/jbc.275.1.599. PMID 10617656.
  71. Chughtai N, Schimchowitsch S, Lebrun JJ, Ali S (Aug 2002). "Prolactin induces SHP-2 association with Stat5, nuclear translocation, and binding to the beta-casein gene promoter in mammary cells". J. Biol. Chem. 277 (34): 31107–14. doi:10.1074/jbc.M200156200. PMID 12060651.

Dopunska literatura

[uredi | uredi izvor]

Vanjski linkovi

[uredi | uredi izvor]

Šablon:Protein-tirozin fosfataze