SOX21

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
SOX21
Identifikatori
AliasiSOX21
Vanjski ID-jeviOMIM: 604974 MGI: 2654070 HomoloGene: 5143 GeneCards: SOX21
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za SOX21
Genomska lokacija za SOX21
Bend13q32.1Početak94,709,622 bp[1]
Kraj94,712,545 bp[1]
Lokacija gena (miš)
Hromosom 14 (miš)
Hrom.Hromosom 14 (miš)[2]
Hromosom 14 (miš)
Genomska lokacija za SOX21
Genomska lokacija za SOX21
Bend14|14 E4Početak118,470,644 bp[2]
Kraj118,474,442 bp[2]
Obrazac RNK ekspresije
PBB GE SOX21 208468 at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001131, GO:0001151, GO:0001130, GO:0001204 DNA-binding transcription factor activity
DNA binding
GO:0000980 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001077, GO:0001212, GO:0001213, GO:0001211, GO:0001205 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001200, GO:0001133, GO:0001201 DNA-binding transcription factor activity, RNA polymerase II-specific
Ćelijska komponenta Jedro
ćelijska komponenta
Biološki proces hair follicle development
GO:0044324, GO:0003256, GO:1901213, GO:0046019, GO:0046020, GO:1900094, GO:0061216, GO:0060994, GO:1902064, GO:0003258, GO:0072212 regulation of transcription by RNA polymerase II
hair cycle
GO:0009373 regulation of transcription, DNA-templated
transcription, DNA-templated
stem cell differentiation
skin development
transcription by RNA polymerase II
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
GO:1901227 negative regulation of transcription by RNA polymerase II
Ćelijska diferencijacija
central nervous system development
neuron differentiation
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_007084

NM_177753

RefSeq (bjelančevina)

NP_009015

NP_808421

Lokacija (UCSC)Chr 13: 94.71 – 94.71 MbChr 14: 118.47 – 118.47 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Transkripcijski faktor SOX-21 je protein koji je kod ljudi kodiran genom SOX21 [5][6] Član je porodice transkripcijskih faktora Sox .

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 276 aminokiselina, a molekulska težina 28.580 Da.[7]

1020304050
MSKPVDHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLT
ESEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKTLLKKDKFAFPVPYGL
GGVADAEHPALKAGAGLHAGAGGGLVPESLLANPEKAAAAAAAAAARVFF
PQSAAAAAAAAAAAAAGSPYSLLDLGSKMAEISSSSSGLPYASSLGYPTA
GAGAFHGAAAAAAAAAAAAGGHTHSHPSPGNPGYMIPCNCSAWPSPGLQP
PLAYILLPGMGKPQLDPYPAAYAAAL
Simboli

Funkcija[uredi | uredi izvor]

U embrionu kokoši, Sox21 promovira neuronsku ćelijskudiferencijaciju, suzbijajući aktivnost Sox1, Sox2 i Sox3, koji održavaju neuronske ćelije u nediferenciranom stanju.[8]

SOX21 nokaut-miševs eksprimira gubitak dlake, počevši od 11. dana nakon porođaja. Ponovni rast započeo je nekoliko dana kasnije, ali je uslijedio ponovni gubitak dlake. Sox21 je također eksprimiran i u kutikulaama dlake kod ljudi, pa bi varijante gena Sox21 mogle biti odgovorne za neka stanja opadanja kose.[9]

Također pogledajte[uredi | uredi izvor]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000125285 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000061517 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Malas S, Duthie S, Deloukas P, Episkopou V (Sep 1999). "The isolation and high-resolution chromosomal mapping of human SOX14 and SOX21; two members of the SOX gene family related to SOX1, SOX2, and SOX3". Mammalian Genome. 10 (9): 934–7. doi:10.1007/s003359901118. PMID 10441749. S2CID 27862567.
  6. ^ "Entrez Gene: SOX21 SRY (sex determining region Y)-box 21".
  7. ^ "UniProt, Q9Y651". Pristupljeno 2017-09-11. CS1 održavanje: nepreporučeni parametar (link)
  8. ^ Sandberg M, Källström M, Muhr J (Aug 2005). "Sox21 promotes the progression of vertebrate neurogenesis". Nature Neuroscience. 8 (8): 995–1001. doi:10.1038/nn1493. PMID 15995704. S2CID 25515445.
  9. ^ Kiso M, Tanaka S, Saba R, Matsuda S, Shimizu A, Ohyama M, Okano HJ, Shiroishi T, Okano H, Saga Y (Jun 2009). "The disruption of Sox21-mediated hair shaft cuticle differentiation causes cyclic alopecia in mice". Proceedings of the National Academy of Sciences of the United States of America. 106 (23): 9292–7. Bibcode:2009PNAS..106.9292K. doi:10.1073/pnas.0808324106. PMC 2695080. PMID 19470461. SažetakReuters UK.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]