TDRD3

S Wikipedije, slobodne enciklopedije
TDRD3
Protein TDRD3 PDB 1wji.png
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1WJI, 2LTO, 3PMT, 3PNW, 3S6W

Identifikatori
AliasiTDRD3
Vanjski ID-jeviOMIM: 614392 MGI: 2444023 HomoloGene: 12771 GeneCards: TDRD3
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za TDRD3
Genomska lokacija za TDRD3
Bend13q21.2Početak60,396,457 bp[1]
Kraj60,573,878 bp[1]
Lokacija gena (miš)
Hromosom 14 (miš)
Hrom.Hromosom 14 (miš)[2]
Hromosom 14 (miš)
Genomska lokacija za TDRD3
Genomska lokacija za TDRD3
Bend14|14 E1Početak87,654,075 bp[2]
Kraj87,782,940 bp[2]
Obrazac RNK ekspresije
PBB GE TDRD3 214028 x at fs.png

PBB GE TDRD3 208089 s at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija methylated histone binding
GO:0001105 transcription coactivator activity
chromatin binding
GO:0001948, GO:0016582 protein binding
RNA binding
Ćelijska komponenta citoplazma
exon-exon junction complex
Jedro
Nukleoplazma
Golđijev aparat
citosol
Biološki proces regulation of nucleic acid-templated transcription
GO:0031497, GO:0006336, GO:0034724, GO:0001301, GO:0007580, GO:0034652, GO:0010847 chromatin organization
positive regulation of nucleic acid-templated transcription
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001146070
NM_001146071
NM_030794

NM_001253755
NM_172605

RefSeq (bjelančevina)

NP_001139542
NP_001139543
NP_110421

NP_001240684
NP_766193

Lokacija (UCSC)Chr 13: 60.4 – 60.57 MbChr 14: 87.65 – 87.78 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Tudorski domenski protein 3 jeprotein koji je kod ljudi kodiran genom TDRD3 .[5] Goulet et al. (2008) navode da se gen TDRD3 nalazi u hromosomu 13, sekvenca 13q21.2. Utvrdili su da gen TDRD3 sadrži 14 egzona i da obuhvata oko 176,5 kb. Egzon 14 nije kodirajući.[6]

TDRD3 ije multifunkcijski protein koji djeluje kao as a transcripcijski koaktivator iu jedru i skelskim proteinima pri stresu citoplazmatskih granula (Yang et al., 2010). Sadrži tudorski i UBA proteinski domen i ima tri različite izoforme

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 651 aminokiselina, a molekulska težina 73.185 Da.[7].

1020304050
MLRLQMTDGHISCTAVEFSYMSKISLNTPPGTKVKLSGIVDIKNGFLLLN
DSNTTVLGGEVEHLIEKWELQRSLSKHNRSNIGTEGGPPPFVPFGQKCVS
HVQVDSRELDRRKTLQVTMPVKPTNDNDEFEKQRTAAIAEVAKSKETKTF
GGGGGGARSNLNMNAAGNRNREVLQKEKSTKSEGKHEGVYRELVDEKALK
HITEMGFSKEASRQALMDNGNNLEAALNVLLTSNKQKPVMGPPLRGRGKG
RGRIRSEDEEDLGNARPSAPSTLFDFLESKMGTLNVEEPKSQPQQLHQGQ
YRSSNTEQNGVKDNNHLRHPPRNDTRQPRNEKPPRFQRDSQNSKSVLEGS
GLPRNRGSERPSTSSVSEVWAEDRIKCDRPYSRYDRTKDTSYPLGSQHSD
GAFKKRDNSMQSRSGKGPSFAEAKENPLPQGSVDYNNQKRGKRESQTSIP
DYFYDRKSQTINNEAFSGIKIEKHFNVNTDYQNPVRSNSFIGVPNGEVEM
PLKGRRIGPIKPAGPVTAVPCDDKIFYNSGPKRRSGPIKPEKILESSIPM
EYAKMWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEV
LLSNIKPIQTEAWEEEGTYDQTLEFRRGGDGQPRRSTRPTQQFYQPPRAR
N
Simboli

Funkcija gena[uredi | uredi izvor]

Linder et al. (2008) otkrili su da je izolirani UBA domen TDRD3 vezan za ubikvitinske veze preko lys48 u lancu tetraubikvitina, ali ne i za monoubikvitin, lys63-ubikvitin ili SUMO1 . Analiza kvaščeve 2-hibridne biblioteke cDNK ljudskog mozga otkrila je da je TDRD3 u interakciji s FXR1. Eksperimenti otpuštanja proteina i koimunoprecipitacije pokazali su da je TDRD3 također u interakciji s FMRP (FMR1) i FXR2. Prekomjerna ekspresija/nadekspresija TDRD3 ili izloženost arsenitu, u HeLa ćelijama uzrokovala je stvaranje stresnih granula koje sadrže TDRD3, FMRP, DAP5 (EIF4G2) i TIAR (TIAL1). Analiza mutacije otkrila je da je regija C-terminalna na tudorskom domenu TDRD3 u interakciji s dva neovisna domena u FMRP-u. Otkrili su da mutacija ile304-to-asn (I304N) u FMRP-u, koja je povezana sa sindromom fragilnog X , poništava interakciju između TDRD3 i FMRP-a.[8]

Nezavisno, Goulet et al. (2008) identificirali su TDRD3 kao komponentu granula citoplazmatskog stresa. TDRD3 nakupljen u granulama stresa nakon ćelijskog stresa izazvanog arsenitom i kolokaliziran s FMRP-om i proteinom G3BP koji veže RNK. I FMRP i TDRD3 slijedili su poliribosome izolirane iz normalnih i stresnih HeLa ćelija, duž kolone za isključivanje veličine. Analiza mutacije otkrila je da je tudorski domen TDRD3 neophodan i dovoljan za translokaciju TDRD3 u granule naprezanja nakon tretmana arsenitom. Eksperimenti smanjenja proteina pokazali su da je TDRD3 u interakciji s proteinima uključenim u obradu RNK, uključujući proteine bogate argininom i glicinom EWS (EWSR1), FUS, DDX3 (DDX3X), SERBP1 i EEF1A1. Objavili suda je tudorski domen tudora simetrični motiv vezanja dimetiliranog arginina (sDMA), te su otkrili in vitroda je izolirana tudor domen TDRD3 vezanog imobiliziranog sDMA. Mutacija glu691 u lys (E691K) unutar tudor domene TDRD3 poništila je ovu interakciju. Mutacija E691K je također eliminirala ili oslabila interakciju TDRD3 s EWS, FUS, DDX3 i EEF1A1 i smanjila regrutiranje TDRD3 u granule pod stresom.

Yang et al. (2010) pregledali su mikromrežu proteinskog domena na molekule koje mogu očitati oznake metilarginina povezane s transkripcijskom aktivacijom. Otkrili su da je TDRD3 vezan za aktivirajuću asimetričnu oznaku dimetilarginina na histonu H4 arg3 (H4R3me2a) kataliziranom pomoću PRMT1 i na H3R17me2a, uz katalizator CARM1. TDRD3 je prepoznao oznaku SDMA H4R3me2s, ali slabije. TDRD3 je funkcionirao kao koaktivator u reporterskim testovima ovisnim o reporterima, estrogenim receptorima (ER ili ESR1) i androgenim receptorima (AR). Analiza imunoprecipitacijske sekvence hromatina otkrila je da je TDRD3 općenito povezan s početnim mjestima transkripcije i da je povezan s promotorom pS2 (TFF1) na način ovisan o CARM1 u ćelijama MCF7 ljudskog raka dojke. Nokautiranje endogenog TDRD3 u MCF7 u ćelijama smanjilo je ER-ovisnu reportersku aktivnost i smanjilo ekspresiju TFF1, NRAS i DDX5. Zaključili su da je TDRD3 protein koji veže metilarginin i koji ima različite uloge u jedru i citoplazmi. Pretpostavili su da je u jedru TDRD3 efektorska molekula za metilne oznake generirane od CARM1 i PRMT1 i da funkcionira kao transkripcijski koaktivator. U citoplazmi, TDRD3 se akumulira u stresnim granulama, kao odgovor na stres i funkcionira kao molekula skele.[9]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000083544 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000022019 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: TDRD3 tudor domain containing 3". CS1 održavanje: nepreporučeni parametar (link)
  6. ^ Goulet, Boisvenue, S., Mokas, S., Mazroui, R., Cote, J. TDRD3, a novel tudor domain-containing protein, localizes to cytoplasmic stress granules. Hum. Molec. Genet. 17: 3055-3074, 2008. PubMed: 18632687
  7. ^ "UniProt, Q9H7E2". Pristupljeno 2021-08-05. CS1 održavanje: nepreporučeni parametar (link)
  8. ^ Linder, B., Plottner, O., Kroiss, M., Hartmann, E., Laggerbauer, B., Meister, G., Keidel, E., Fischer, U. Tdrd3 is a novel stress granule-associated protein interacting with the fragile-X syndrome protein FMRP. Hum. Molec. Genet. 17: 3236-3246, 2008. PubMed: 18664458
  9. ^ Yang, Y., Lu, Y., Espejo, A., Wu, J., Xu, W., Liang, S., Bedford, M. T. TDRD3 is an effector molecule for arginine-methylated histone marks. Molec. Cell 40: 1016-1023, 2010. PubMed: 21172665

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]