TMEM242

S Wikipedije, slobodne enciklopedije
TMEM242
Identifikatori
AliasiTMEM242
Vanjski ID-jeviMGI: 1917794 HomoloGene: 44020 GeneCards: TMEM242
Lokacija gena (čovjek)
Hromosom 6 (čovjek)
Hrom.Hromosom 6 (čovjek)[1]
Hromosom 6 (čovjek)
Genomska lokacija za TMEM242
Genomska lokacija za TMEM242
Bend6q25.3Početak157,289,025 bp[1]
Kraj157,323,601 bp[1]
Lokacija gena (miš)
Hromosom 17 (miš)
Hrom.Hromosom 17 (miš)[2]
Hromosom 17 (miš)
Genomska lokacija za TMEM242
Genomska lokacija za TMEM242
Bend17|17 A1Početak5,461,145 bp[2]
Kraj5,490,534 bp[2]
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_018452

NM_027457

RefSeq (bjelančevina)

NP_060922

NP_081733

Lokacija (UCSC)Chr 6: 157.29 – 157.32 MbChr 17: 5.46 – 5.49 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Transmembranski protein 242 jest protein koji je kod ljudi kodiran genom TMEM242 Gen TMEM242 nalazi se na dugom kraku (q) hromosoma 6, u prugi 2, sekvenca 5.3. Ovaj protein se obično naziva i C6orf35, BM033 i UPF0463 transmembranski protein otvoreni okvir čitanja 35 C6orf35. Gen tmem242 dug je 35.238 parova baza, a protein ima 141 aminokiselinu. Sadrži četiri egzona.[5] U naučnoj zajednici, funkcijsa ovog protein još nije dobro razjašnjena. Ovaj protein sadrži DUF1358 domen (domen nepoznate funkcije 1358).[6]

Pregled[uredi | uredi izvor]

Oksidacija energetski bogatih spojeva generira pokretačku silu protona, hemijsku razliku potencijala za protone, preko unutrašnjih mitohondrijskih membrana. Pokretačka sila protona pokreće okretanje rotora u membranskom domenu ATP-sintaze. Ova rotacija daje energiju za sintetiziranje ATP-a potrebnog za održavanje života. Sastav u unutrašnjoj podjedinici organelnoj membrani ljudske ATP-sintaze od 27 jedarno kodiranih proteina i dvije mitohondrijski kodirane podjedinice, uključuje stvaranje međumodula koji predstavljaju F1-katalitski domen, perifernu dršku i c8-prsten u membranskom dijelu rotora . Sklapanje c8-prstena zahtijeva sudjelovanje dva proteina povezana s membranom, TMEM70 i TMEM242

Ljudska mitohondrijska ATP-sintaza je molekulski mehanizam s rotacijskim djelovanjem vezanim za unutrašnje membrane organela. Okretanje rotora, izazvano pokretačkom silom protona, daje energiju za stvaranje ATP-a iz ADP-a i fosfata. Među 29 komponentnih proteina 18 tipova, ATP6 i ATP8 su proizvodi mitohondrijskih, a ostatak su jedarnih gena koji se unose u organele. ATP-sintaza se od njih sastavlja putem posrednih modula, koji predstavljaju glavne strukturne elemente enzima. Jedan takav modul je c8-prsten, koji osigurava membranski sektor enzimskog rotora, a na njegovo sastavljanje utiče drugi transmembranski protein (TMEM), TMEM70. Pokazano je da podjedinica c stupa u interakciju s TMEM70 i drugim dosad neidentificiranim mitohondrijskim transmembranskim proteinima, TMEM242. Delecija TMEM242, slično deleciji TMEM70 utiče na, ali ne i potpuno uklanja, sklop ATP-sintaze i u manjoj mjeri skup respiratornih enzimskih kompleksa I, III i IV. Delecija TMEM70 i TMEM242 zajedno sprečava sklapanje ATP-sintaze i povećava se uticaj na kompleks I. Uklanjanje TMEM242, ali ne i TMEM70, također utče na uvođenje podjedinica ATP6, ATP8, j i k u enzim. TMEM70 i TMEM242 stupaju u interakciju s kompleksom mitohondrijskog kompleksa I (MCIA) koji podržava sastavljanje membranskog kraka kompleksa I. Interakcije TMEM70 i TMEM242 s MCIA mogu biti dio ili sklopa ATP sintaze i kompleksa I ili regulacije njihovih nivoa sastavljanja za kompleks[7]

ATP-sintaza u ljudskim mitohondrijama daje većinu ćelijskih ATP-a u aerobnim uvjetima. Energija dobijena oksidativnim metabolizmom stvara protonsku motornu silu preko unutrašnje mitohondrijske membrane (IMM), a ATP-sintaza iskorištava protonsku snagu za stvaranje ATP-a iz ADP-a i fosfata rotacijskim mehanizmom (1⇓ – 3). Humana ATP sintaza je skup od 29 podjedinica od 18 tipova (uključujući regulatorni protein, IF1) sa kombinovanom molekulskom masom od 591 kDa. U monomernom kompleksu vezanom za membranu, podjedinice su organizirane u komponente rotora i statora ove molekuskoge mehanizma, a monomere tvore dimere, raspoređene u dugim redovima duž vrhova kristala u IMM-u (5⇓⇓ –8). U svakom monomernom kompleksu, dvije membranske podjedinice, ATP6 i ATP8, kodirane su u mitohondrijskoj DNK, dok su ostale podjedinice jedarno kodirani proteini, sintetizirani u citosolu i uvezeni u IMM i matriks organele, gdje se sastavlja enzimski kompleks. Ovaj međuprodukt sastoji se od F1-katalitskoge domena vezanog za membranski povezanu komponentu c8-prstena rotora enzima plus produženi kompleks perifernih drški (PS) vezan za F1-domen i proteže se u membranski domen enzima. Pokazano je da se do ovog međuprodukta može doći putem tri neovisne rute, gdje se PS-uključujući pridružene podjedinice membrane e, f i g-gradi pomoću dva alternativna puta na unaprijed sastavljenom među prstenu F1-c8, a treći gdje c8-prsten se dodaje u prethodno sastavljeni F1-PS kompleks.[7]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 141 aminokiselina, а molekulska težina 14.758 Da.[8]

1020304050
METAGAATGQPASGLEAPGSTNDRLFLVKGGIFLGTVAAAGMLAGFITTL
SLAKKKSPEWFNKGSMATAALPESGSSLALRALGWGSLYAWCGVGVISFA
VWKALGVHSMNDFRSKMQSIFPTIPKNSESAVEWEETLKSK

Domen[uredi | uredi izvor]

Protein TMEM242 ima konzervirani domen, nepoznate funkcije pfam 07096, DUF 1358., koji pokriva prvih 121 aminokiselina u proteinu. Kod eukariota, ovaj domen je konzerviran.

Pridruženi proteini[uredi | uredi izvor]

Identificirano je nekoliko predviđenih proteina u interakciji i funkcionalnih mjesta na proteinu. Jedan od predviđenih proteina u interakciji je MAP2K1IP1, protein skele.[9] Poznato je da je ovaj protein uključen u put MAP-kinaze. Put MAP-kinaze povezan je s Alzheimerovim putem preko proteina zvanog Tau ili MAPT. Pretjerana fosforilacija ovog proteina dovodi do agregacije neurona što može uzrokovati Alzheimerovu bolest. Drugi povezani proteini uključuju GGT7,[10][11] RNF5,[10][11] ELOVL4,[10] GPR42,[10] BCL2L13,[10] HEATR1,[12] IZUMO4,[12] ARID1B,[12] SIAE,[12] EDARADD,[12] URB1,[12] ZDHHC14,[12] KIF11,[12] RRM2,[12] KCTD13,[12] TMEM31,[11] NDUFA3,[11] SGPL1,[11] CNR2,[11] i GJA8.[11] Svi navedeni proteini imaju poznate funkcije.

Funkcija[uredi | uredi izvor]

Protein tmem242 visoko je ekspimiran u mnogim tkivima, ali najviše u mozgu, srcu, nadbubrežnim žlijezdama i štitnjači.[13]

Homolozi i ortolozi[uredi | uredi izvor]

Postoje homolozi i ortolozi proteina tmem242 u različitim vrstama. Vrste su se divergirale prije oko 794 miliona godina.[14] The following species have been found as having orthologs to the tmem242 protein in their genome:[15]


Korigirana divergencija TMEM242 u poređenju sa fibrinogenom citohromom C
Slika desno predstavlja stopu divergencije za TMEM242 (plavo) u odnosu na fibrinogen (crveno) i citohrom C (zeleno). Ovaj grafikon pokazuje da TMEM242 evolira brzinom koja je između brzine fibrinogena, koja brzo i citoroma C, koji sporo evoluira

Genski nivo regulacije[uredi | uredi izvor]

Promotor gena TMEM242 nalazi se uzvodno, ali uključuje transkripcijsko i translacijsko početno mjesto. Ovaj promotor je pronađen pomoću ElDorado-a preko Genomatix -a.[16] Ovaj promotor ima mnogo lokacija za vezivanje transkripcijskog faktora. Neki od ovih transkripcijskih faktora uključuju TFIIB, faktor sličan mišjem krupelu i NKX faktore homeodomena. Jedan značajan transkripcijski faktor je protein koji se veže za retinoblastom i djeluje na demetilazu. Postoji sveprisutna ekspresija baznog nivoa TMEM242 u svim tkivima čovjeka[5] i miša.[17] Postoje i druga tkiva s povećanim nivoom ekspresije, kao što su u malom mozgu i hipokampusu. Postoji povećanje nivoa ekspresije u mnogim dijelovima mozga zajedno s bubrezima i prostatom.[18] TMEM242 eksprimira se slabije u nekim organima, kao što su srce, nadbubrežne žlijezde i štitnjačad.[5]

Transkripcijski nivo regulacije[uredi | uredi izvor]

Tmem242 ima nekoliko predviđenih post-transkripcijskih struktura matične petlje u 5' UTR-u.[19] Ove strukture koriste vezivanje, uobičajeno i modificirano, za stvaranje struktura matične petlje u neprevedenim regijama iRNK.

Regulacija na nivou proteina[uredi | uredi izvor]

Postoje različiti oblici regulacije na nivoa proteina za TMEM242. Nalazi vjerojatno u ćelijskoj membrani,[20] or the mitochondrial membrane,[21] ali moguće su i druge potćelijske lokacije. To uključuje endoplazmatski retikulum i jedarnu membranu. Na TMEM242 postoje različita mjesta fosforilacije. Ova mjesta uključuju cAMP i cGMP-ovisna mjesta fosforilacije protein-kinaze, mjesta fosforilacije kazei-kinaze II i mjesto fosforilacije protein-kinaze C.[22] Sve ove lokacije favoriziraju fosforilaciju ostataka serina i treonina. Ostale posttranslacijske modifikacije uključuju mjesto N-miristoilacije, koje kovalentno dodaje molekulu miristata.

Sastav proteina[uredi | uredi izvor]

Postoje različiti jednonukleotidni polimorfizmi (SNP) koji se mogu pojaviti u TMEM242. Neki uzrokuju stop kodone, drugi čine tihe mutacije ili misens mutacije.

TMEM242 ima 141 aminokiselinu i sadrži najmanje jedan ostatak svake aminokiseline. Postoje dva transmembranska domena, jedan se proteže od približno 28. do 48. ostatka. Drugi domen proteže se od približno 82. do 102. ostatka.[23] Ovi brojevi aminokiselinskih ostaka su približni jer različiti izvori imaju aproksimacije za transmembranske domene.

Sekundarna struktura[uredi | uredi izvor]

TMEM242 ima nekoliko sekundarnih struktura. Dva transmembranska domena imaju alfa-helikse[24] Ove spirale nastaju od nenabijenih ostataka koji su u membrani i nisu izloženi vezivanju. Ostali dijelovi proteina TMEM242 mogu formirati sekundarne strukture.

Tercijarna struktura[uredi | uredi izvor]

Protein TMEM242 se dalje presavija do svoje konačne strukture i ugrađuje u membranu, u koju je vjerovatno ugrađen ,[25] a postoji i potencijal da se ugradi u mitohondrijsku membranu ili membranu endoplazmatskog retikuluma.

Posttranslacijske modifikacije[uredi | uredi izvor]

TMEM242 prolazi kroz različite posttranslacijske modifikacije. Postoji 11 serinskih ostataka koji imaju potencijal za fosfolilaciju. Ta se mjesta nalaze u ostacima 13, 20, 51, 57, 65, 74, 76, 77, 119, 128 i 130.[26] Postoje i četiri ostatka treonina koji imaju potencijal fosforilacije. Ta mjesta su ostataci pod brojem 36, 49, 123 i 137.[26] Ostale posttranslacijske modifikacije koje se potencijalno mogu dogoditi na određenim motivima. U TMEM242 postoji 12 mjesta s motivima koja koreliraju s četiri različita tipamotiva. Četiri tipa su mjesto fosforilacije protein-kinaze zavisne od cAMP-a i cGMP-a, mjesto fosforilacije kazein-kinaze II, mjesto N-miristoilacije i mjesto fosforilacije protein-kinaze C.[27] U TMEM242 postoji jedno mjesto fosforilacije protein-kinaze ovisne o cAMP i cGMP, a ovaj motiv preferira fosforilaciju ostataka treonina i serina.[27] Postoje četiri mjesta fosforilacije kazein-kinaze II, a ovaj motiv je serin/treonin-kinaza. Tu je i postoji šest mjesta N-miristoilacije, a ovaj motiv signalizira kovalentno vezivanje miristata.[27] Postoji i jedno mjesto fosforilacije protein-kinaze C koje signalizira fosforilaciju ostataka serina ili treonina.[27]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000215712 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000004945 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b c "transmembrane protein 242 [Homo sapiens]". Protein – NCBI. National Center for Biotechnology Information, U.S. National Library of Medicine. Pristupljeno 26. 2. 2019.
  6. ^ "Pfam Family: DUF1358 (PF07096)". Pfam.
  7. ^ a b Joe Carroll, Jiuya He, Shujing Ding, M. Fearnley, E. Walker (2021). "TMEM70 and TMEM242 help to assemble the rotor ring of human ATP synthase and interact with assembly factors for complex I." PNAS (13): e2100558118. Zanemaren tekst "volume118" (pomoć)CS1 održavanje: upotreba parametra authors (link)
  8. ^ "UniProt, Q9NWH2" (jezik: engleski). Pristupljeno 11. 10. 2021.
  9. ^ "C6orf35 protein (Homo sapiens)". STRING interaction network.[mrtav link]
  10. ^ a b c d e Calderone A. "TMEM242". Mentha: the intercome browser.
  11. ^ a b c d e f g "48 binary interactions found for search term tmem242". IntAct Molecular Interaction Database. EMBL-EBI.
  12. ^ a b c d e f g h i j "STRING: functional protein association networks". string-db.org. Pristupljeno 22. 4. 2019.
  13. ^ "TMEM242 transmembrane protein 242 [Homo sapiens (human)]". Gene - NCBI. National Center for Biotechnology Information, U.S. National Library of Medicine. Pristupljeno 26. 2. 2019.
  14. ^ "TimeTree :: The Timescale of Life". timetree.org. Pristupljeno 4. 3. 2019.
  15. ^ "HomoloGene:44020". HomoloGene. National Center for Biotechnology Information, U.S. National Library of Medicine.
  16. ^ "Genomatix - NGS Data Analysis & Personalized Medicine". www.genomatix.de. Pristupljeno 15. 5. 2019.
  17. ^ "Experiment Detail :: Allen Brain Atlas: Mouse Brain". mouse.brain-map.org. Pristupljeno 15. 5. 2019.
  18. ^ . doi:10.7287/peerj.preprints.26870v1/supp-19 //doi.org/10.7287%2Fpeerj.preprints.26870v1%2Fsupp-19. journal zahtijeva |journal= (pomoć); Parametar |title= nedostaje ili je prazan (pomoć)
  19. ^ "Figure S10: Putative secondary structures of the four IGRs (A-D correspond to IGRs in Fig. 2 from left to right) from the filiferanHydractinia symbiolongicarpususing the RNA Folding Form of the mfold Web Server (mfold.rna.albany.edu/?q=mfold)". doi:10.7717/peerj.1403/supp-10. journal zahtijeva |journal= (pomoć)
  20. ^ "PSORT II Prediction". psort.hgc.jp. Pristupljeno 15. 5. 2019.
  21. ^ "PredictProtein - Protein Sequence Analysis, Prediction of Structural and Functional Features". predictprotein.org. Pristupljeno 15. 5. 2019.
  22. ^ "Motif Scan". myhits.isb-sib.ch (jezik: engleski). Pristupljeno 15. 5. 2019.
  23. ^ "The European Bioinformatics Institute < EMBL-EBI". www.ebi.ac.uk. Pristupljeno 22. 4. 2019.
  24. ^ "PredictProtein - Protein Sequence Analysis, Prediction of Structural and Functional Features". predictprotein.org. Pristupljeno 22. 4. 2019.
  25. ^ "PSORT WWW Server". psort.hgc.jp. Pristupljeno 22. 4. 2019.
  26. ^ a b "ExPaSy (Expert Protein Analysis System)", Encyclopedic Dictionary of Genetics, Genomics and Proteomics, John Wiley & Sons, Inc., 15. 7. 2004, doi:10.1002/0471684228.egp04300, ISBN 978-0471684220
  27. ^ a b c d "SIB myhits". SIB.

Vanjski linkovi[uredi | uredi izvor]

Dopunska literatura[uredi | uredi izvor]