Tireoidna peroksidaza

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
Tireoidna peroksidaza
Identifikatori
Aliasi
Vanjski ID-jeviGeneCards: [1]
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

n/a

n/a

RefSeq (bjelančevina)

n/a

n/a

Lokacija (UCSC)n/an/a
PubMed pretragan/an/a
Wikipodaci
Pogledaj/uredi – čovjek
Jodidna peroksidaza
4cit.jpg
Monomer jodid-peroksidaze Zobellia galactanivorans
Identifikatori
Simbol?
CAS broj9031-28-1
Tiroidna peroksidaza
Identifikatori
SimbolTPO
Alt. simboliTHO
NCBI gen7173
HGNC12015
OMIM606765
RefSeqNM_175722
UniProtP07202
Ostali podaci
EC broj1.11.1.8
LokusHrom. 2 pter-p24
Pretraga za
StruktureSwiss-model
DomeneInterPro

Tiroidna peroksidaza, znana i kao tiroperoksidaza (TPO) ili jodna perokidaza, jest enzim koji je kod ljudi kodiran genom sa hromosoma 2. To je enzim koji je eksprimiran uglavnom u štitnjači, gdje se izlučuje u koloid. Peroksidaza štitnjače oksidira ione jodida da formira atome joda za dodavanje na tirozinskim ostacima na tiroglobulinu, za proizvodnju tiroksin a(T4) ili trijodtironina (T3), hormona štitnjače.[1][2]

Amiokiselininska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 933 aminokiseline, a molekulska težina 102.963 Da.[3].

1020304050
MRALAVLSVTLVMACTEAFFPFISRGKELLWGKPEESRVSSVLEESKRLV
DTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQA
MKRKVNLKTQQSQHPTDALSEDLLSIIANMSGCLPYMLPPKCPNTCLANK
YRPITGACNNRDHPRWGASNTALARWLPPVYEDGFSQPRGWNPGFLYNGF
PLPPVREVTRHVIQVSNEVVTDDDRYSDLLMAWGQYIDHDIAFTPQSTSK
AAFGGGADCQMTCENQNPCFPIQLPEEARPAAGTACLPFYRSSAACGTGD
QGALFGNLSTANPRQQMNGLTSFLDASTVYGSSPALERQLRNWTSAEGLL
RVHARLRDSGRAYLPFVPPRAPAACAPEPGIPGETRGPCFLAGDGRASEV
PSLTALHTLWLREHNRLAAALKALNAHWSADAVYQEARKVVGALHQIITL
RDYIPRILGPEAFQQYVGPYEGYDSTANPTVSNVFSTAAFRFGHATIHPL
VRRLDASFQEHPDLPGLWLHQAFFSPWTLLRGGGLDPLIRGLLARPAKLQ
VQDQLMNEELTERLFVLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGL
PRLETPADLSTAIASRSVADKILDLYKHPDNIDVWLGGLAENFLPRARTG
PLFACLIGKQMKALRDGDWFWWENSHVFTDAQRRELEKHSLSRVICDNTG
LTRVPMDAFQVGKFPEDFESCDSITGMNLEAWRETFPQDDKCGFPESVEN
GDFVHCEESGRRVLVYSCRHGYELQGREQLTCTQEGWDFQPPLCKDVNEC
ADGAHPPCHASARCRNTKGGFQCLCADPYELGDDGRTCVDSGRLPRVTWI
SMSLAALLIGGFAGLTSTVICRWTRTGTKSTLPISETGGGTPELRCGKHQ
AVGTSPQRAAAQDSEQESAGMEGRDTHRLPRAL

Katalizirana reakcija[uredi | uredi izvor]

L-tirozin + I + H+ + H2O23-Jod-L-tirozin + 2 H2O

Jodid se oksidira u jodni radikal koji odmah reagira s tirozinom.

3-Jod-L-tirozin + I + H+ + H2O23,5-Dijod-L-tirozin + 2 H2O

Drugi atom joda se dodaje na sličan način u reakcijski intermedijer 3-jodotirozin.

Funkcija[uredi | uredi izvor]

Sinteza tiroidnih hormona, sa tiroidnom peroksidazom koja izvodi korak oksidacije koji se vidi u sredini lijevo.[4]

Neorganski jod ulazi u tijelo prvenstveno kao jodid, I. Nakon ulaska u folikul štitaste žlezde (ili folikulne ćelije štitne žlezde) preko Na+/I simportera (NIS) na bazolateralnoj strani, jodid se prenosi preko apikalne membrane u koloid putem pendrina, nakon čega se tiroidna peroksidaza oksidira pretvarajući jodid u atomski jod (I) ili jod (I+). "Organizacija joda," ugradnja joda u tireoglobulin za proizvodnju hormona štitnjače, je nespecifična; to jest, ne postoji intermedijer vezan za TPO, ali se jodiranje događa preko reaktivnih jodnih vrsta oslobođenih iz TPO.[5] Hemijske reakcije koje katalizira tiroidna peroksidaza odvijaju se na vanjskoj površini apikalne membrane i posredovane su vodik-peroksidom.

Stimulacija i inhibicija[uredi | uredi izvor]

TPO je stimuliran tiroid stimulirajućim hormonom (TSH), koji povećava ekspresiju gena.

TPO inhibiraju tioamidni lijekovi, kao što su propiltiouracil i metimazol.[6] Kod laboratorijskih pacova sa nedovoljnim unosom joda, genistein je pokazao inhibiciju TPO.[7]

Klinički značaj[uredi | uredi izvor]

Peroksidaza štitnjače je čest epitop autoantitijela kod autoimunskih bolesti štitne žlijezde, a takva antitijela se nazivaju antitijela na peroksidazu štitnjače (anti-TPO antitijela). Ovo je najčešće povezano sa Hashimotovim tireoiditisom. Stoga se titar antitijela može koristiti za procjenu aktivnosti bolesti kod pacijenata koji su razvili takva antitijela.[8][9]

Dijagnostička upotreba[uredi | uredi izvor]

U dijagnostičkoj imunohistohemiji, ekspresija tiroidne peroksidaze (TPO) se gubi u papilskom karcinomu štitnjače.[10]

Reference[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]

Šablon:Enzimi i transporteri metabolizma hormona Šablon:Peroksidaze

Šablon:Modulatori receptore tiroidnog hormona

  1. ^ Ruf J, Carayon P (Jan 2006). "Structural and functional aspects of thyroid peroxidase". Archives of Biochemistry and Biophysics. 445 (2): 269–77. doi:10.1016/j.abb.2005.06.023. PMID 16098474.
  2. ^ Kimura S, Kotani T, McBride OW, Umeki K, Hirai K, Nakayama T, Ohtaki S (Aug 1987). "Human thyroid peroxidase: complete cDNA and protein sequence, chromosome mapping, and identification of two alternately spliced mRNAs". Proceedings of the National Academy of Sciences of the United States of America. 84 (16): 5555–9. Bibcode:1987PNAS...84.5555K. doi:10.1073/pnas.84.16.5555. PMC 298901. PMID 3475693.
  3. ^ "UniProt, P07202" (jezik: engleski). Pristupljeno 15. 11. 2021.
  4. ^ Walter F., PhD. Boron (2003). Medical Physiology: A Cellular And Molecular Approaoch. Elsevier/Saunders. str. 1300. ISBN 1-4160-2328-3.
  5. ^ Kessler J, Obinger C, Eales G (Jul 2008). "Factors influencing the study of peroxidase-generated iodine species and implications for thyroglobulin synthesis". Thyroid. 18 (7): 769–74. doi:10.1089/thy.2007.0310. PMID 18631006.
  6. ^ Nagasaka A, Hidaka H (Jul 1976). "Effect of antithyroid agents 6-propyl-2-thiouracil and 1-methyl-2-mercaptoimidazole on human thyroid iodine peroxidase". The Journal of Clinical Endocrinology and Metabolism. 43 (1): 152–8. doi:10.1210/jcem-43-1-152. PMID 947933.
  7. ^ Doerge DR, Sheehan DM (Jun 2002). "Goitrogenic and estrogenic activity of soy isoflavones". Environmental Health Perspectives. 110 Suppl 3: 349–53. doi:10.1289/ehp.02110s3349. PMC 1241182. PMID 12060828.
  8. ^ McLachlan SM, Rapoport B (2000). "Autoimmune response to the thyroid in humans: thyroid peroxidase--the common autoantigenic denominator". International Reviews of Immunology. 19 (6): 587–618. doi:10.3109/08830180009088514. PMID 11129117. S2CID 11431166.
  9. ^ Chardès T, Chapal N, Bresson D, Bès C, Giudicelli V, Lefranc MP, Péraldi-Roux S (Jun 2002). "The human anti-thyroid peroxidase autoantibody repertoire in Graves' and Hashimoto's autoimmune thyroid diseases". Immunogenetics. 54 (3): 141–57. doi:10.1007/s00251-002-0453-9. PMID 12073143. S2CID 2701974.
  10. ^ Tanaka T, Umeki K, Yamamoto I, Sugiyama S, Noguchi S, Ohtaki S (maj 1996). "Immunohistochemical loss of thyroid peroxidase in papillary thyroid carcinoma: strong suppression of peroxidase gene expression". The Journal of Pathology. 179 (1): 89–94. doi:10.1002/(SICI)1096-9896(199605)179:1<89::AID-PATH546>3.0.CO;2-R. PMID 8691351.