UBL3

S Wikipedije, slobodne enciklopedije
UBL3
Protein UBL3 PDB 1wgh.png
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2GOW

Identifikatori
AliasiUBL3
Vanjski ID-jeviOMIM: 604711 MGI: 1344373 HomoloGene: 5153 GeneCards: UBL3
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za UBL3
Genomska lokacija za UBL3
Bend13q12.3Početak29,764,371 bp[1]
Kraj29,850,617 bp[1]
Lokacija gena (miš)
Hromosom 5 (miš)
Hrom.Hromosom 5 (miš)[2]
Hromosom 5 (miš)
Genomska lokacija za UBL3
Genomska lokacija za UBL3
Bend5|5 G3Početak148,504,635 bp[2]
Kraj148,552,789 bp[2]
Obrazac RNK ekspresije
PBB GE UBL3 201535 at fs.png

PBB GE UBL3 201534 s at fs.png
Više referentnih podataka o ekspresiji
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_007106

NM_011908

RefSeq (bjelančevina)

NP_009037

NP_036038
NP_001346128
NP_001346129
NP_001346130
NP_001346131

Lokacija (UCSC)Chr 13: 29.76 – 29.85 MbChr 5: 148.5 – 148.55 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Ubikvitinoliki protein 3 je protein je kod ljudi kodiran genom UBL3.[5][6]

Hibridnim mapiranjem somatskih ćelija, Chadwick et al. (1999) locirali su ljidskii gen UBL3 na hromosomu 13, sekvenca 13q12-q13. Koristeći fluorescentnu hibridizaciju in situ, mapirali su i mišji gen Ubl3 na telomerni kraj hromosoma 5 u pojasu G2-3, regiji koja pokazuje homologiju sintenije sa ljudskim 13q.[7]

U melanocitnim ćelijama ekspresija gena UBL3 može se regulirati transkripcijskim faktorom, povezanim s mikroftalmijom (MITF).[8]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 227 aminokiselina, a molekulska težina 13.157 Da.[9]

1020304050
MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEE
QVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQ
GQRNREKTGESNCCVIL
Simboli

Kloniranje i ekspresija[uredi | uredi izvor]

Trodimenzijska struktura ubikvitinskog proteina

Ubikvitin cilja proteine za razgradnju 26S, proteasomom. Nasuprot tome, proteini slični ubikvitinu (UBL) (npr. UBL1) možda nisu direktno uključeni u razgradnju proteina, ali izgleda da imaju raznolik raspon ćelijskih funkcija (pregled Hodges et al., 1998). Gorepomenuti Chadwick et al. (1999) identifikovali su gen Drosophila UBL3. Pretražujući EST bazu podataka, koristeći cDNK Drosophila UBL3 kao upit, identifikovali su ljudski UBL3 EST. Koristeći EST, izolirali su cDNK matičnih ćelija ljudskih keratinocita koje imaju kompletnu sekvencu kodiranja UBL3. Izvedeni ljudski protein UBL3sa 117 aminokiselina sadrži dva potencijalna mjesta N-glikozilacije, potencijalno mjesto fosforilacije C-proteinske kinaze i potencijalno mjesto prednilacije C-terminala. Relativno je hidrofilan, bez predviđenih transmembranskih domena. Ljudski UBL3 deli 69% identiteta aminokiselinske sekvence sa jednim oblikom drozofilinog UBL3 i 99% identiteta sa mišjim Ubl3, cDNK. Northern blot analiza ljudskih tkiva otkrila je transkripte UBL3 od 3,5 i 4,5 kb u svim testiranim tkivima, kao što su slezena, [timus]], leukociti periferne krvi, sjemenici, jajnici, posteljica, prostata, jetra, [[gušterača, tanko i debelo crijevo, te bubreg, srce, pluća, mozak i skeletni mišići. Dodatni transkripti od 2,0 i 3,0 kb pronađeni su u testisima. Identificirali su tri signala poliadenilacije, koji rezultiraju alternativno poliadeniliranim transkriptima UBL3.[10]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000122042 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000001687 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Chadwick BP, Kidd T, Sgouros J, Ish-Horowicz D, Frischauf AM (Aug 1999). "Cloning, mapping and expression of UBL3, a novel ubiquitin-like gene". Gene. 233 (1–2): 189–95. doi:10.1016/S0378-1119(99)00138-9. PMID 10375635.
  6. ^ "Entrez Gene: UBL3 ubiquitin-like 3".
  7. ^ Chadwick, B. P., Kidd, T., Sgouros, J., Ish-Horowicz, D., Frischauf, A.-M. Cloning, mapping and expression of UBL3, a novel ubiquitin-like gene. Gene 233: 189-195, 1999. PubMed: 10375635
  8. ^ Hoek KS, Schlegel NC, Eichhoff OM, et al. (2008). "Novel MITF targets identified using a two-step DNA microarray strategy". Pigment Cell Melanoma Res. 21 (6): 665–76. doi:10.1111/j.1755-148X.2008.00505.x. PMID 19067971.
  9. ^ "UniProt, O95164". Pristupljeno 2017-09-11. CS1 održavanje: nepreporučeni parametar (link)
  10. ^ Hodges, M., Tissot, C., Freemont, P. S. Protein regulation: tag wrestling with relatives of ubiquitin. Curr. Biol. 8: R749-R752, 1998. PubMed: 9799726

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]