WBP4

S Wikipedije, slobodne enciklopedije
WBP4
Protein WBP4 PDB 2dk1.png
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2DK1, 2JXW

Identifikatori
AliasiWBP4
Vanjski ID-jeviOMIM: 604981 MGI: 109568 HomoloGene: 38287 GeneCards: WBP4
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za WBP4
Genomska lokacija za WBP4
Bend13q14.11Početak41,061,509 bp[1]
Kraj41,084,006 bp[1]
Lokacija gena (miš)
Hromosom 14 (miš)
Hrom.Hromosom 14 (miš)[2]
Hromosom 14 (miš)
Genomska lokacija za WBP4
Genomska lokacija za WBP4
Bend14|14 D3Početak79,697,377 bp[2]
Kraj79,718,960 bp[2]
Obrazac RNK ekspresije
PBB GE WBP4 203598 s at fs.png

PBB GE WBP4 203597 s at fs.png

PBB GE WBP4 203599 s at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija zinc ion binding
proline-rich region binding
GO:0001948, GO:0016582 protein binding
metal ion binding
nucleic acid binding
Ćelijska komponenta nuclear speck
spliceosomal complex
Nukleoplazma
Jedro
U2-type precatalytic spliceosome
Biološki proces mRNA cis splicing, via spliceosome
mRNA processing
Prerada RNK
mRNA splicing, via spliceosome
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_007187

NM_018765

RefSeq (bjelančevina)

NP_009118

NP_061235

Lokacija (UCSC)Chr 13: 41.06 – 41.08 MbChr 14: 79.7 – 79.72 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

WW domen-vezujući protein 4 je proteinkoji je kod ljudi kodiran genom WBP4.[5][6]

Ovaj gen kodira domen WW, koji sadrži vezujući protein 4. WW domen predstavlja malu i kompaktnu koptastu strukturu koja stupa u interakciju s prolinom bogatim ligandima. Ovaj kodirani protein je općeniti splajsosomni protein koji može imati ulogu u unakrsnom premošćivanju U1 i U2 snRNP-ova u splajsosomnom kompleksu A.[6]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 376 aminokiselina, a molekulska težina 42.507 Da.[7].

1020304050
MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQK
SLDKAKEEEKASKEFAAMEAAALKAYQEDLKRLGLESEILEPSITPVTST
IPPTSTSNQQKEKKEKKKRKKDPSKGRWVEGITSEGYHYYYDLISGASQW
EKPEGFQGDLKKTAVKTVWVEGLSEDGFTYYYNTETGESRWEKPDDFIPH
TSDLPSSKVNENSLGTLDESKSSDSHSDSDGEQEAEEGGVSTETEKPKIK
FKEKNKNSDGGSDPETQKEKSIQKQNSLGSNEEKSKTLKKSNPYGEWQEI
KQEVESHEEVDLELPSTENEYVSTSEADGGGEPKVVFKEKTVTSLGVMAD
GVAPVFKKRRTENGKSRNLRQRGDDQ
Simboli

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000120688 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000022023 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Bedford MT, Reed R, Leder P (Sep 1998). "WW domain-mediated interactions reveal a spliceosome-associated protein that binds a third class of proline-rich motif: the proline glycine and methionine-rich motif". Proc Natl Acad Sci U S A. 95 (18): 10602–7. doi:10.1073/pnas.95.18.10602. PMC 27941. PMID 9724750.
  6. ^ a b "Entrez Gene: WBP4 WW domain binding protein 4 (formin binding protein 21)". CS1 održavanje: nepreporučeni parametar (link)
  7. ^ "UniProt, O75554". Pristupljeno 2021-08-05. CS1 održavanje: nepreporučeni parametar (link)

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]