ZC3H13

S Wikipedije, slobodne enciklopedije
ZC3H13
Identifikatori
AliasiZC3H13
Vanjski ID-jeviOMIM: 616453 GeneCards: ZC3H13
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za ZC3H13
Genomska lokacija za ZC3H13
Bend13q14.13Početak45,954,465 bp[1]
Kraj46,052,759 bp[1]
Obrazac RNK ekspresije
PBB GE ZC3H13 209851 at fs.png

PBB GE ZC3H13 212402 at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 protein binding
metal ion binding
RNA binding
Ćelijska komponenta nuclear speck
Jedro
Nukleoplazma
RNA N6-methyladenosine methyltransferase complex
Biološki proces mRNA processing
multicellular organism development
Prerada RNK
mRNA methylation
regulation of stem cell population maintenance
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)
NM_015070
NM_001076788
NM_001330564
NM_001330565
NM_001330566

NM_001330567
NM_001382206
NM_001382207
NM_001382208
NM_001382209
NM_001382210
NM_001382211
NM_001382212
NM_001382213
NM_001382214

n/a

RefSeq (bjelančevina)
NP_001070256
NP_001317493
NP_001317494
NP_001317495
NP_001317496

NP_055885
NP_001369135
NP_001369136
NP_001369137
NP_001369138
NP_001369139
NP_001369140
NP_001369141
NP_001369142
NP_001369143

n/a

Lokacija (UCSC)Chr 13: 45.95 – 46.05 Mbn/a
PubMed pretraga[2]n/a
Wikipodaci
Pogledaj/uredi – čovjek

Protein 13 cinkovog prsta sa CCCH domenom je protein koji je kod ljudi [[kodon|kodiran] genom ZC3H13, sa hromosoma 13, sekvenca q14:45,954.464 – 46,052,793 (prema NCBI) .[3][4]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 1.668 aminokiselina, a molekulska težina 196.635 Da.[5].

1020304050
MSKIRRKVTVENTKTISDSTSRRPSVFERLGPSTGSTAETQCRNWLKTGN
CLYGNTCRFVHGPSPRGKGYSSNYRRSPERPTGDLRERMKNKRQDVDTEP
QKRNTEESSSPVRKESSRGRHREKEDIKITKERTPESEEENVEWETNRDD
SDNGDINYDYVHELSLEMKRQKIQRELMKLEQENMEKREEIIIKKEVSPE
VVRSKLSPSPSLRKSSKSPKRKSSPKSSSASKKDRKTSAVSSPLLDQQRN
SKTNQSKKKGPRTPSPPPPIPEDIALGKKYKEKYKVKDRIEEKTRDGKDR
GRDFERQREKRDKPRSTSPAGQHHSPISSRHHSSSSQSGSSIQRHSPSPR
RKRTPSPSYQRTLTPPLRRSASPYPSHSLSSPQRKQSPPRHRSPMREKGR
HDHERTSQSHDRRHERREDTRGKRDREKDSREEREYEQDQSSSRDHRDDR
EPRDGRDRRDARDTRDRRELRDSRDMRDSREMRDYSRDTKESRDPRDSRS
TRDAHDYRDREGRDTHRKEDTYPEESRSYGRNHLREESSRTEIRNESRNE
SRSEIRNDRMGRSRGRVPELPEKGSRGSRGSQIDSHSSNSNYHDSWETRS
SYPERDRYPERDNRDQARDSSFERRHGERDRRDNRERDQRPSSPIRHQGR
NDELERDERREERRVDRVDDRRDERARERDRERERDRERERERERERDRE
REKERELERERAREREREREKERDRERDRDRDHDRERERERERDREKERE
REREERERERERERERERERERERERARERDKERERQRDWEDKDKGRDDR
REKREEIREDRNPRDGHDERKSKKRYRNEGSPSPRQSPKRRREHSPDSDA
YNSGDDKNEKHRLLSQVVRPQESRSLSPSHLTEDRQGRWKEEDRKPERKE
SSRRYEEQELKEKVSSVDKQREQTEILESSRMRAQDIIGHHQSEDRETSD
RAHDENKKKAKIQKKPIKKKKEDDVGIERGNIETTSEDGQVFSPKKGQKK
KSIEKKRKKSKGDSDISDEEAAQQSKKKRGPRTPPITTKEELVEMCNGKN
GILEDSQKKEDTAFSDWSDEDVPDRTEVTEAEHTATATTPGSTPSPLSSL
LPPPPPVATATATTVPATLAATTAAAATSFSTSAITISTSATPTNTTNNT
FANEDSHRKCHRTRVEKVETPHVTIEDAQHRKPMDQKRSSSLGSNRSNRS
HTSGRLRSPSNDSAHRSGDDQSGRKRVLHSGSRDREKTKSLEITGERKSR
IDQLKRGEPSRSTSSDRQDSRSHSSRRSSPESDRQVHSRSGSFDSRDRLQ
ERDRYEHDRERERERRDTRQREWDRDADKDWPRNRDRDRLRERERERERD
KRRDLDRERERLISDSVERDRDRDRDRTFESSQIESVKRCEAKLEGEHER
DLESTSRDSLALDKERMDKDLGSVQGFEETNKSERTESLEGDDESKLDDA
HSLGSGAGEGYEPISDDELDEILAGDAEKREDQQDEEKMPDPLDVIDVDW
SGLMPKHPKEPREPGAALLKFTPGAVMLRVGISKKLAGSELFAKVKETCQ
RLLEKPKDADNLFEHELGALNMAALLRKEERASLLSNLGPCCKALCFRRD
SAIRKQLVKNEKGTIKQAYTSAPMVDNELLRLSLRLFKRKTTCHAPGHEK
TEDNKLSQSSIQQELCVS
Simboli

Kloniranje i ekspresija[uredi | uredi izvor]

Sekvenciranjem klonova dobijenih iz biblioteke cDNK ljudskog mozga frakcionirane veličine, Nagase et al. (1998) klonirali su ZC3H13, koji su označili kao KIAA0853. Izvedeni protein od 967 aminokiselina ima slabu homologiju s ljudskim trihohialinom (TCHH). RT-PCR ELISA testom otkrili je najjaču ekspresiju KIAA0853 u jetri, jajnicima i mozgu, zatim u bubrezima. Umjerena ekspresija otkrivena je u srcu, plućima, skeletnim mišićima, gušterači i sjemenicima.[6]

Funkcija gena[uredi | uredi izvor]

Koristeći masenu spektrometrijsku analizu za identifikaciju proteina koji su imunoprecipitirani sa WTAP iz endotelnih ćelija ljudske pupčane vene (HUVEC), Horiuchi et al. (2013) identificirali su proteinski kompleks, koji je uključivao KIAA0853, HAKAI (CBLL1), virilizer (KIAA1429), RBM15, BCLAF1 i THRAP3. WTAP kompleks lokaliziran na jedarnim pjegama HeLa ćelija i HUVEC-ovima, a eksperimenti umrežavanja pokazali su da je prolazno povezan s faktorima prerade. Nokauniranje bilo koje komponente WTAP kompleksa, uključujući KIAA0853, smanjilo je alternativnu preradu WTAP-a, što je rezultiralo povećanom proizvodnjom proteina pune dužine WTAP-a i smanjenom proliferacijom ćelija, sa zastojem ćelijskog ciklusa u fazi G2. Razgradnja BCLAF1 i THRAP3 smanjila je lokalizaciju jedarnih pjega drugih komponenti WTAP kompleksa.[7]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000123200 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O (May 1999). "Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro". DNA Res. 5 (6): 355–64. doi:10.1093/dnares/5.6.355. PMID 10048485.
  4. ^ "Entrez Gene: ZC3H13 zinc finger CCCH-type containing 13".
  5. ^ "UniProt, Q5T200". Pristupljeno 2017-09-11. CS1 održavanje: nepreporučeni parametar (link)
  6. ^ Nagase, T., Ishikawa, K., Suyama, M., Kikuno, R., Hirosawa, M., Miyajima, N., Tanaka, A., Kotani, H., Nomura, N., Oharo, O. Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 5: 355-364, 1998. PubMed: 10048485
  7. ^ Horiuchi, K., Kawamura, T., Iwanari, H., Ohashi, R., Naito, M., Kodama, T., Hamakubo, T. Identification of Wilms' tumor 1-associating protein complex and its role in alternative splicing and the cell cycle. J. Biol. Chem. 288: 33292-33302, 2013. PubMed: 24100041

Dopunska literatura[uredi | uredi izvor]