ATF3

S Wikipedije, slobodne enciklopedije
ATF3
Identifikatori
AliasiATF3
Vanjski ID-jeviOMIM: 603148 MGI: 109384 HomoloGene: 1265 GeneCards: ATF3
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za ATF3
Genomska lokacija za ATF3
Bend1q32.3Početak212,565,334 bp[1]
Kraj212,620,777 bp[1]
Lokacija gena (miš)
Hromosom 1 (miš)
Hrom.Hromosom 1 (miš)[2]
Hromosom 1 (miš)
Genomska lokacija za ATF3
Genomska lokacija za ATF3
Bend1 H6|1 96.28 cMPočetak190,902,493 bp[2]
Kraj190,950,236 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0000975 transcription cis-regulatory region binding
protein homodimerization activity
GO:0001948, GO:0016582 vezivanje za proteine
RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001078, GO:0001214, GO:0001206 DNA-binding transcription repressor activity, RNA polymerase II-specific
protein heterodimerization activity
vezivanje identičnih proteina
GO:0001077, GO:0001212, GO:0001213, GO:0001211, GO:0001205 DNA-binding transcription activator activity, RNA polymerase II-specific
vezivanje sa DNK
GO:0001106 transcription corepressor activity
GO:0001131, GO:0001151, GO:0001130, GO:0001204 DNA-binding transcription factor activity
GO:0000980 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001200, GO:0001133, GO:0001201 DNA-binding transcription factor activity, RNA polymerase II-specific
Ćelijska komponenta Jedarce
nukleoplazma
CHOP-ATF3 complex
jedro
Biološki proces GO:0044324, GO:0003256, GO:1901213, GO:0046019, GO:0046020, GO:1900094, GO:0061216, GO:0060994, GO:1902064, GO:0003258, GO:0072212 regulation of transcription by RNA polymerase II
positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
positive regulation of cell population proliferation
skeletal muscle cell differentiation
regulation of transcription from RNA polymerase II promoter in response to arsenic-containing substance
Glukoneogeneza
cellular response to amino acid starvation
GO:0045996 negative regulation of transcription, DNA-templated
GO:0009373 regulation of transcription, DNA-templated
positive regulation of TRAIL-activated apoptotic signaling pathway
transcription, DNA-templated
GO:1901313 positive regulation of gene expression
PERK-mediated unfolded protein response
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
negative regulation of ERK1 and ERK2 cascade
GO:1901227 negative regulation of transcription by RNA polymerase II
endoplasmic reticulum unfolded protein response
transcription by RNA polymerase II
positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)
NM_001030287
NM_001040619
NM_001206484
NM_001206485
NM_001206486

NM_001206488
NM_001674
NM_004024

NM_007498

RefSeq (bjelančevina)
NP_001025458
NP_001035709
NP_001193413
NP_001193415
NP_001193417

NP_001665

NP_031524

Lokacija (UCSC)Chr 1: 212.57 – 212.62 MbChr 1: 190.9 – 190.95 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

CAMP-ovisni transkripcijski faktor ATF-3 jest protein koji je kod ljudi kodiran genom ATF3 sa hromosoma 1.[5]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 181 aminokiselina, a molekulska težina 20.576 Da.[6]

1020304050
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQ
NKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAA
AKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHR
PTCIVRAQNGRTPEDERNLFIQQIKEGTLQS

Funkcija[uredi | uredi izvor]

Aktivirajući transkripcijski faktor 3 je član porodice proteina transkripcijskih faktora aktivacije sisarakog/cAMP koji reaguje na elemente koji vezuju (CREB). Za ovaj gen pronađeno je više varijanti transkripta, koje kodiraju dvije različite izoforme. Duža izoformi potiskuje, a ne aktivira transkripciju sa promotora sa ATF veznim elementima. Kraćoj izoformi (deltaZip2) nedostaje leucinski zatvarač, motiv dimerizacije proteina i ne vezuje se za DNK, a stimulira transkripciju, pretpostavlja se, izdvajanjem inhibitornih kofaktora od promotora. Moguće je da alternativna prerada ATF3 gena može biti fiziološki važna u regulaciji ciljnih gena.[7]

Klinički značaj[uredi | uredi izvor]

ATF-3 ie induciran fiziološkim stresom u različitim tkivima.[8] Također je marker regeneracije nakon ozljede ganglijskih neurona dorzalnog korijena, jer ozlijeđeni regenerirajući neuroni aktiviraju ovaj transkripcijski faktor.[9] Studije funkcionalne validacije pokazale su da ATF3 može promovirati regeneraciju perifernih neurona, ali nije sposoban promovirati regeneraciju neurona centralnog nervnog sistema.[10]

Interakcije[uredi | uredi izvor]

Pokazalo se da je ATF3 u interakciji sa:

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000162772 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000026628 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Chen BP, Liang G, Whelan J, Hai T (juni 1994). "ATF3 and ATF3 delta Zip. Transcriptional repression versus activation by alternatively spliced isoforms". The Journal of Biological Chemistry. 269 (22): 15819–26. doi:10.1016/S0021-9258(17)40754-X. PMID 7515060.
  6. ^ "UniProt, P18847" (jezik: en.). Pristupljeno 7. 12. 2021.CS1 održavanje: nepoznati jezik (link)
  7. ^ "Entrez Gene: ATF3 activating transcription factor 3".
  8. ^ a b c Chen BP, Wolfgang CD, Hai T (mart 1996). "Analysis of ATF3, a transcription factor induced by physiological stresses and modulated by gadd153/Chop10". Molecular and Cellular Biology. 16 (3): 1157–68. doi:10.1128/MCB.16.3.1157. PMC 231098. PMID 8622660.
  9. ^ Lindå H, Sköld MK, Ochsmann T (2011). "Activating transcription factor 3, a useful marker for regenerative response after nerve root injury". Frontiers in Neurology. 2: 30. doi:10.3389/fneur.2011.00030. PMC 3099310. PMID 21629765.
  10. ^ Mahar M, Cavalli V (juni 2018). "Intrinsic mechanisms of neuronal axon regeneration". Nature Reviews. Neuroscience (jezik: engleski). 19 (6): 323–337. doi:10.1038/s41583-018-0001-8. PMC 5987780. PMID 29666508.
  11. ^ Pearson AG, Gray CW, Pearson JF, Greenwood JM, During MJ, Dragunow M (decembar 2003). "ATF3 enhances c-Jun-mediated neurite sprouting". Brain Research. Molecular Brain Research. 120 (1): 38–45. doi:10.1016/j.molbrainres.2003.09.014. PMID 14667575.
  12. ^ Hai T, Curran T (maj 1991). "Cross-family dimerization of transcription factors Fos/Jun and ATF/CREB alters DNA binding specificity". Proceedings of the National Academy of Sciences of the United States of America. 88 (9): 3720–4. Bibcode:1991PNAS...88.3720H. doi:10.1073/pnas.88.9.3720. PMC 51524. PMID 1827203.
  13. ^ Chu HM, Tan Y, Kobierski LA, Balsam LB, Comb MJ (januar 1994). "Activating transcription factor-3 stimulates 3',5'-cyclic adenosine monophosphate-dependent gene expression". Molecular Endocrinology. 8 (1): 59–68. doi:10.1210/mend.8.1.8152431. PMID 8152431.
  14. ^ Stelzl U, Worm U, Lalowski M, Haenig C, Brembeck FH, Goehler H, Stroedicke M, Zenkner M, Schoenherr A, Koeppen S, Timm J, Mintzlaff S, Abraham C, Bock N, Kietzmann S, Goedde A, Toksöz E, Droege A, Krobitsch S, Korn B, Birchmeier W, Lehrach H, Wanker EE (septembar 2005). "A human protein-protein interaction network: a resource for annotating the proteome". Cell. 122 (6): 957–68. doi:10.1016/j.cell.2005.08.029. hdl:11858/00-001M-0000-0010-8592-0. PMID 16169070. S2CID 8235923.
  15. ^ Yan C, Wang H, Boyd DD (mart 2002). "ATF3 represses 72-kDa type IV collagenase (MMP-2) expression by antagonizing p53-dependent trans-activation of the collagenase promoter". The Journal of Biological Chemistry. 277 (13): 10804–12. doi:10.1074/jbc.M112069200. PMID 11792711.
  16. ^ Kang Y, Chen CR, Massagué J (april 2003). "A self-enabling TGFbeta response coupled to stress signaling: Smad engages stress response factor ATF3 for Id1 repression in epithelial cells". Molecular Cell. 11 (4): 915–26. doi:10.1016/s1097-2765(03)00109-6. PMID 12718878.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]

Ovaj članak uključuje tekst iz Nacionalne medicinske biblioteke Sjedinjenih Država, koji je u javnom vlasništvu.


  1. ^ Koh EH, Park JY, Park HS, Jeon MJ, Ryu JW, Kim M, Kim SY, Kim MS, Kim SW, Park IS, Youn JH, Lee KU (decembar 2007). "Essential role of mitochondrial function in adiponectin synthesis in adipocytes". Diabetes. 56 (12): 2973–81. doi:10.2337/db07-0510. PMID 17827403.