FCGBP

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
FCGBP
Identifikatori
AliasiFCGBP
Vanjski ID-jeviOMIM: 617553 MGI: 2444336 HomoloGene: 68369 GeneCards: FCGBP
Lokacija gena (čovjek)
Hromosom 19 (čovjek)
Hrom.Hromosom 19 (čovjek)[1]
Hromosom 19 (čovjek)
Genomska lokacija za FCGBP
Genomska lokacija za FCGBP
Bend19q13.2Početak39,863,323 bp[1]
Kraj39,934,626 bp[1]
Lokacija gena (miš)
Hromosom 7 (miš)
Hrom.Hromosom 7 (miš)[2]
Hromosom 7 (miš)
Genomska lokacija za FCGBP
Genomska lokacija za FCGBP
Bend7|7 A3Početak28,071,236 bp[2]
Kraj28,120,862 bp[2]
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_003890

NM_001122603
NM_175444

RefSeq (bjelančevina)

NP_003881

n/a

Lokacija (UCSC)Chr 19: 39.86 – 39.93 MbChr 7: 28.07 – 28.12 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

IgGFc-vezujući protein je protein koji je kod ljudi kodiran genom FCGBP.[5][6]
Aminokiselinska sekvenca

Simboli
1020304050
MGALWSWWILWAGATLLWGLTQEASVDLKNTGREEFLTAFLQNYQLAYSK
AYPRLLISSLSESPASVSILSQADNTSKKVTVRPGESVMVNISAKAEMIG
SKIFQHAVVIHSDYAISVQALNAKPDTAELTLLRPIQALGTEYFVLTPPG
TSARNVKEFAVVAGAAGASVSVTLKGSVTFNGKFYPAGDVLRVTLQPYNV
AQLQSSVDLSGSKVTASSPVAVLSGHSCAQKHTTCNHVVEQLLPTSAWGT
HYVVPTLASQSRYDLAFVVASQATKLTYNHGGITGSRGLQAGDVVEFEVR
PSWPLYLSANVGIQVLLFGTGAIRNEVTYDPYLVLIPDVAAYCPAYVVKS
VPGCEGVALVVAQTKAISGLTIDGHAVGAKLTWEAVPGSEFSYAEVELGT
ADMIHTAEATTNLGLLTFGLAKAIGYATAADCGRTVLSPVEPSCEGMQCA
AGQRCQVVGGKAGCVAESTAVCRAQGDPHYTTFDGRRYDMMGTCSYTMVE
LCSEDDTLPAFSVEAKNEHRGSRRVSYVGLVTVRAYSHSVSLTRGEVGFV
LVDNQRSRLPVSLSEGRLRVYQSGPRAVVELVFGLVVTYDWDCQLALSLP
ARFQDQVCGLCGNYNGDPADDFLTPDGALAPDAVEFASSWKLDDGDYLCE
DGCQNNCPACTPGQAQHYEGDRLCGMLTKLDGPFAVCHDTLDPRPFLEQC
VYDLCVVGGERLSLCRGLSAYAQACLELGISVGDWRSPANCPLSCPANSR
YELCGPACPTSCNGAAAPSNCSGRPCVEGCVCLPGFVASGGACVPASSCG
CTFQGLQLAPGQEVWADELCQRRCTCNGATHQVTCRDKQSCPAGERCSVQ
NGLLGCYPDRFGTCQGSGDPHYVSFDGRRFDFMGTCTYLLVGSCGQNAAL
PAFRVLVENEHRGSQTVSYTRAVRVEARGVKVAVRREYPGQVLVDDVLQY
LPFQAADGQVQVFRQGRDAVVRTDFGLTVTYDWNARVTAKVPSSYAEALC
GLCGNFNGDPADDLALRGGGQAANALAFGNSWQEETRPGCGATEPGDCPK
LDSLVAQQLQSKNECGILADPKGPFRECHSKLDPQGAVRDCVYDRCLLPG
QSGPLCDALATYAAACQAAGATVHPWRSEELCPLSCPPHSHYEACSYGCP
LSCGDLPVPGGCGSECHEGCVCDEGFALSGESCLPLASCGCVHQGTYHPP
GQTFYPGPGCDSLCHCQEGGLVSCESSSCGPHEACQPSGGSLGCVAVGSS
TCQASGDPHYTTFDGRRFDFMGTCVYVLAQTCGTRPGLHRFAVLQENVAW
GNGRVSVTRVITVQVANFTLRLEQRQWKVTVNGVDMKLPVVLANGQIRAS
QHGSDVVIETDFGLRVAYDLVYYVRVTVPGNYYQQMCGLCGNYNGDPKDD
FQKPNGSQAGNANEFGNSWEEVVPDSPCLPPTPCPPGSEDCIPSHKCPPE
LEKKYQKEEFCGLLSSPTGPLSSCHKLVDPQGPLKDCIFDLCLGGGNLSI
LCSNIHAYVSACQAAGGHVEPWRTETFCPMECPPNSHYELCADTCSLGCS
ALSAPPQCQDGCAEGCQCDSGFLYNGQACVPIQQCGCYHNGVYYEPEQTV
LIDNCRQQCTCHAGKGMVCQEHSCKPGQVCQPSGGILSCVTKDPCHGVTC
RPQETCKEQGGQGVCLPNYEATCWLWGDPHYHSFDGRKFDFQGTCNYVLA
TTGCPGVSTQGLTPFTVTTKNQNRGNPAVSYVRVVTVAALGTNISIHKDE
IGKVRVNGVLTALPVSVADGRISVTQGASKALLVADFGLQVSYDWNWRVD
VTLPSSYHGAVCGLCGNMDRNPNNDQVFPNGTLAPSIPIWGGSWRAPGWD
PLCWDECRGSCPTCPEDRLEQYEGPGFCGPLAPGTGGPFTTCHAHVPPES
FFKGCVLDVCMGGGDRDILCKALASYVAACQAAGVVIEDWRAQVGCEITC
PENSHYEVCGSPCPASCPSPAPLTTPAVCEGPCVEGCQCDAGFVLSADRC
VPLNNGCGCWANGTYHEAGSEFWADGTCSQWCRCGPGGGSLVCTPASCGL
GEVCGLLPSGQHGCQPVSTAECQAWGDPHYVTLDGHRFNFQGTCEYLLSA
PCHGPPLGAENFTVTVANEHRGSQAVSYTRSVTLQIYNHSLTLSARWPRK
LQVDGVFVTLPFQLDSLLHAHLSGADVVVTTTSGLSLAFDGDSFVRLRVP
AAYAGSLCGLCGNYNQDPADDLKAVGGKPAGWQVGGAQGCGECVSKPCPS
PCTPEQQESFGGPDACGVISATDGPLAPCHGLVPPAQYFQGCLLDACQVQ
GHPGGLCPAVATYVAACQAAGAQLREWRRPDFCPFQCPAHSHYELCGDSC
PGSCPSLSAPEGCESACREGCVCDAGFVLSGDTCVPVGQCGCLHDDRYYP
LGQTFYPGPGCDSLCRCREGGEVSCEPSSCGPHETCRPSGGSLGCVAVGS
TTCQASGDPHYTTFDGRRFDFMGTCVYVLAQTCGTRPGLHRFAVLQENVA
WGNGRVSVTRVITVQVANFTLRLEQRQWKVTVNGVDMKLPVVLANGQIRA
SQHGSDVVIETDFGLRVAYDLVYYVRVTVPGNYYQLMCGLCGNYNGDPKD
DFQKPNGSQAGNANEFGNSWEEVVPDSPCLPPPTCPPGSEGCIPSEECPP
ELEKKYQKEEFCGLLSSPTGPLSSCHKLVDPQGPLKDCIFDLCLGGGNLS
ILCSNIHAYVSACQAAGGQVEPWRNETFCPMECPQNSHYELCADTCSLGC
SALSAPLQCPDGCAEGCQCDSGFLYNGQACVPIQQCGCYHNGAYYEPEQT
VLIDNCRQQCTCHVGKVVVCQEHSCKPGQVCQPSGGILSCVNKDPCHGVT
CRPQETCKEQGGQGVCLPNYEATCWLWGDPHYHSFDGRKFDFQGTCNYVL
ATTGCPGVSTQGLTPFTVTTKNQNRGNPAVSYVRVVTVAALGTNISIHKD
EIGKVRVNGVLTALPVSVADGRISVTQGASKALLVADFGLQVSYDWNWRV
DVTLPSSYHGAVCGLCGNMDRNPNNDQVFPNGTLAPSIPIWGGSWRAPGW
DPLCWDECRGSCPTCPEDRLEQYEGPGFCGPLAPGTGGPFTTCHAHVPPE
SFFKGCVLDVCMGGGDRDILCKALASYVAACQAAGVVIEDWRAQVGCEIT
CPENSHYEVCGPPCPASCPSPAPLTTPAVCEGPCVEGCQCDAGFVLSADR
CVPLNNGCGCWANGTYHEAGSEFWADGTCSQWCRCGPGGGSLVCTPASCG
LGEVCGLLPSGQHGCQPVSTAECQAWGDPHYVTLDGHRFDFQGTCEYLLS
APCHGPPLGAENFTVTVANEHRGSQAVSYTRSVTLQIYNHSLTLSARWPR
KLQVDGVFVTLPFQLDSLLHAHLSGADVVVTTTSGLSLAFDGDSFVRLRV
PAAYAGSLCGLCGNYNQDPADDLKAVGGKPAGWQVGGAQGCGECVSKPCP
SPCTPEQQESFGGPDACGVISATDGPLAPCHGLVPPAQYFQGCLLDACQV
QGHPGGLCPAVATYVAACQAAGAQLREWRRPDFCPFQCPAHSHYELCGDS
CPGSCPSLSAPEGCESACREGCVCDAGFVLSGDTCVPVGQCGCLHDDRYY
PLGQTFYPGPGCDSLCRCREGGEVSCEPSSCGPHETCRPSGGSLGCVAVG
STTCQASGDPHYTTFDGHRFDFMGTCVYVLAQTCGTRPGLHRFAVLQENV
AWGNGRVSVTRVITVQVANFTLRLEQRQWKVTVNGVDMKLPVVLANGQIR
ASQHGSDVVIETDFGLRVAYDLVYYVRVTVPGNYYQLMCGLCGNYNGDPK
DDFQKPNGSQAGNANEFGNSWEEVVPDSPCLPPPTCPPGSAGCIPSDKCP
PELEKKYQKEEFCGLLSSPTGPLSSCHKLVDPQGPLKDCIFDLCLGGGNL
SILCSNIHAYVSACQAAGGHVEPWRNETFCPMECPQNSHYELCADTCSLG
CSALSAPLQCPDGCAEGCQCDSGFLYNGQACVPIQQCGCYHNGVYYEPEQ
TVLIDNCRQQCTCHVGKVVVCQEHSCKPGQVCQPSGGILSCVTKDPCHGV
TCRPQETCKEQGGQGVCLPNYEATCWLWGDPHYHSFDGRKFDFQGTCNYV
LATTGCPGVSTQGLTPFTVTTKNQNRGNPAVSYVRVVTVAALGTNISIHK
DEIGKVRVNGVLTALPVSVADGRISVAQGASKALLVADFGLQVSYDWNWR
VDVTLPSSYHGAVCGLCGNMDRNPNNDQVFPNGTLAPSIPIWGGSWRAPG
WDPLCWDECRGSCPTCPEDRLEQYEGPGFCGPLSSGTGGPFTTCHAHVPP
ESFFKGCVLDVCMGGGDRDILCKALASYVAACQAAGVVIEDWRAQVGCEI
TCPENSHYEVCGPPCPASCPSPAPLTTPAVCEGPCVEGCQCDAGFVLSAD
RCVPLNNGCGCWANGTYHEAGSEFWADGTCSQWCRCGPGGGSLVCTPASC
GLGEVCGLLPSGQHGCQPVSTAECQAWGDPHYVTLDGHRFDFQGTCEYLL
SAPCHGPPLGAENFTVTVANEHRGSQAVSYTRSVTLQIYNHSLTLSARWP
RKLQVDGVFVALPFQLDSLLHAHLSGADVVVTTTSGLSLAFDGDSFVRLR
VPAAYAASLCGLCGNYNQDPADDLKAVGGKPAGWQVGGAQGCGECVSKPC
PSPCTPEQQESFGGPDACGVISATDGPLAPCHGLVPPAQYFQGCLLDACQ
VQGHPGGLCPAVATYVAACQAAGAQLGEWRRPDFCPLQCPAHSHYELCGD
SCPVSCPSLSAPEGCESACREGCVCDAGFVLSGDTCVPVGQCGCLHDGRY
YPLGEVFYPGPECERRCECGPGGHVTCQEGAACGPHEECRLEDGVQACHA
TGCGRCLANGGIHYITLDGRVYDLHGSCSYVLAQVCHPKPGDEDFSIVLE
KNAAGDLQRLLVTVAGQVVSLAQGQQVTVDGEAVALPVAVGRVRVTAEGR
NMVLQTTKGLRLLFDGDAHLLMSIPSPFRGRLCGLCGNFNGNWSDDFVLP
NGSAASSVETFGAAWRAPGSSKGCGEGCGPQGCPVCLAEETAPYESNEAC
GQLRNPQGPFATCQAVLSPSEYFRQCVYDLCAQKGDKAFLCRSLAAYTAA
CQAAGVAVKPWRTDSFCPLHCPAHSHYSICTRTCQGSCAALSGLTGCTTR
CFEGCECDDRFLLSQGVCIPVQDCGCTHNGRYLPVNSSLLTSDCSERCSC
SSSSGLTCQAAGCPPGRVCEVKAEARNCWATRGLCVLSVGANLTTFDGAR
GATTSPGVYELSSRCPGLQNTIPWYRVVAEVQICHGKTEAVGQVHIFFQD
GMVTLTPNKGVWVNGLRVDLPAEKLASVSVSRTPDGSLLVRQKAGVQVWL
GANGKVAVIVSNDHAGKLCGACGNFDGDQTNDWHDSQEKPAMEKWRAQDF
SPCYG

Reference[uredi | uredi izvor]

  1. ^ a b c ENSG00000275395 GRCh38: Ensembl release 89: ENSG00000281123, ENSG00000275395 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000047730 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Harada N, Iijima S, Kobayashi K, Yoshida T, Brown WR, Hibi T, Oshima A, Morikawa M (Jul 1997). "Human IgGFc binding protein (FcgammaBP) in colonic epithelial cells exhibits mucin-like structure". J Biol Chem. 272 (24): 15232–41. doi:10.1074/jbc.272.24.15232. PMID 9182547.
  6. ^ "Entrez Gene: FCGBP Fc fragment of IgG binding protein".

Dopunska literatura[uredi | uredi izvor]