HN1 (gen)

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
HN1 (gen)
Identifikatori
AliasiJPT1
Vanjski ID-jeviMGI: 1096361 HomoloGene: 7364 GeneCards: JPT1
Lokacija gena (čovjek)
Hromosom 17 (čovjek)
Hrom.Hromosom 17 (čovjek)[1]
Hromosom 17 (čovjek)
Genomska lokacija za HN1 (gen)
Genomska lokacija za HN1 (gen)
Bend17q25.1Početak75,135,248 bp[1]
Kraj75,168,281 bp[1]
Lokacija gena (miš)
Hromosom 11 (miš)
Hrom.Hromosom 11 (miš)[2]
Hromosom 11 (miš)
Genomska lokacija za HN1 (gen)
Genomska lokacija za HN1 (gen)
Bend11 E2|11 80.84 cMPočetak115,497,353 bp[2]
Kraj115,514,387 bp[2]
Obrazac RNK ekspresije
PBB GE HN1 217755 at fs.png
Više referentnih podataka o ekspresiji
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)
NM_001002032
NM_001002033
NM_001288609
NM_001288610
NM_001288611

NM_016185

NM_008258

RefSeq (bjelančevina)
NP_001002032
NP_001002033
NP_001275538
NP_001275539
NP_001275540

NP_057269

NP_032284

Lokacija (UCSC)Chr 17: 75.14 – 75.17 MbChr 11: 115.5 – 115.51 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Krvno i nervno ekspripimirani protein 1 je protein koji je kod ljudi kodiran genom HN1.[5][6]

Dužina polipeptidnog lanca je 154 aminokiseline, sa molekulskom težinom od 16.015.[7]

Aminokiselinska sekvenca

Simboli
1020304050
MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASN
IFGTPEENQASWAKSAGAKSSGGREDLESSGLQRRNSSEASSGDFLDLKG
EGDIHENVDTDLPGSLGQSEEKPVPAAPVPSPVAPAPVPSRRNPPGGKSS
LVLG

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000189159 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000020737 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Zhou G, Wang J, Zhang Y, Zhong C, Ni J, Wang L, Guo J, Zhang K, Yu L, Zhao S (Apr 2004). "Cloning, expression and subcellular localization of HN1 and HN1L genes, as well as characterization of their orthologs, defining an evolutionarily conserved gene family". Gene. 331: 115–23. doi:10.1016/j.gene.2004.02.025. PMID 15094197.
  6. ^ "Entrez Gene: HN1 hematological and neurological expressed 1".
  7. ^ "UniProt, Q9UK76". Pristupljeno 12. 9. 2017.

Dopunska literatura[uredi | uredi izvor]