ATG4D

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
ATG4D
Identifikatori
AliasiATG4D
Vanjski ID-jeviOMIM: 611340 MGI: 2444308 HomoloGene: 13156 GeneCards: ATG4D
Lokacija gena (čovjek)
Hromosom 19 (čovjek)
Hrom.Hromosom 19 (čovjek)[1]
Hromosom 19 (čovjek)
Genomska lokacija za ATG4D
Genomska lokacija za ATG4D
Bend19p13.2Početak10,543,895 bp[1]
Kraj10,553,418 bp[1]
Lokacija gena (miš)
Hromosom 9 (miš)
Hrom.Hromosom 9 (miš)[2]
Hromosom 9 (miš)
Genomska lokacija za ATG4D
Genomska lokacija za ATG4D
Bend9|9 A3Početak21,265,293 bp[2]
Kraj21,277,772 bp[2]
Ontologija gena
Molekularna funkcija peptidase activity
cysteine-type peptidase activity
hydrolase activity
cysteine-type endopeptidase activity
Ćelijska komponenta citoplazma
citosol
mitochondrial matrix
mitohondrija
Biološki proces Autofagija
protein transport
autophagy of nucleus
C-terminal protein lipidation
protein delipidation
autophagy of mitochondrion
autophagosome assembly
Proteoliza
protein targeting to membrane
Apoptoza
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001281504
NM_032885

NM_153583

RefSeq (bjelančevina)

NP_001268433
NP_116274

NP_705811

Lokacija (UCSC)Chr 19: 10.54 – 10.55 MbChr 9: 21.27 – 21.28 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Ljudski gen ATG4D kodira protein cistein peptidaza s autofagijom 4D.[5]

Aminokiselinska sekvenca kodiranog proteina[uredi | uredi izvor]

Simboli
1020304050
MNSVSPAAAQYRSSSPEDARRRPEARRPRGPRGPDPNGLGPSGASGPALG
SPGAGPSEPDEVDKFKAKFLTAWNNVKYGWVVKSRTSFSKISSIHLCGRR
YRFEGEGDIQRFQRDFVSRLWLTYRRDFPPLPGGCLTSDCGWGCMLRSGQ
MMLAQGLLLHFLPRDWTWAEGMGLGPPELSGSASPSRYHGPARWMPPRWA
QGAPELEQERRHRQIVSWFADHPRAPFGLHRLVELGQSSGKKAGDWYGPS
LVAHILRKAVESCSDVTRLVVYVSQDCTVYKADVARLVARPDPTAEWKSV
VILVPVRLGGETLNPVYVPCVKELLRCELCLGIMGGKPRHSLYFIGYQDD
FLLYLDPHYCQPTVDVSQADFPLESFHCTSPRKMAFAKMDPSCTVGFYAG
DRKEFETLCSELTRVLSSSSATERYPMFTLAEGHAQDHSLDDLCSQLAQP
TLRLPRTGRLLRAKRPSSEDFVFL

Funkcija[uredi | uredi izvor]

Autofagija je proces kojim se endogeni proteini i oštećene organele uništavaju unutarćelijski. Pretpostavlja se da je autofagija bitna za ćelijsku homeostazu ljudi i preuređivanje ćelija tokom diferencijacije, metamorfoze, neapoptotske ćelijske smrti i starenja. Smanjeni nivoi autofagije opisani su kod nekih malignih tumora, a predložena je uloga autofagije i u kontroli nereguliranog rasta ćelija povezanog sa kancerom.

Ovaj gen pripada porodici proteina 4 (Atg4) koja je povezana sa autofagnih C54 endopeptidaza. Članovi ove porodice kodiraju proteine koji imaju ulogu u biogenezi autofagosoma, koji odvajaju citosol i organele za razgradnju pomoću lizosoma. Prerada rezultira višestrukim varijantama transkripata. [prema RefSeq, juli 2013.].

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000130734 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000002820 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: Autophagy related 4D, cysteine peptidase".

Dopunska literatura[uredi | uredi izvor]