KPTN

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
KPTN
Identifikatori
AliasiKPTN
Vanjski ID-jeviOMIM: 615620 MGI: 1890380 HomoloGene: 5127 GeneCards: KPTN
Lokacija gena (čovjek)
Hromosom 19 (čovjek)
Hrom.Hromosom 19 (čovjek)[1]
Hromosom 19 (čovjek)
Genomska lokacija za KPTN
Genomska lokacija za KPTN
Bend19q13.32Početak47,475,150 bp[1]
Kraj47,484,265 bp[1]
Lokacija gena (miš)
Hromosom 7 (miš)
Hrom.Hromosom 7 (miš)[2]
Hromosom 7 (miš)
Genomska lokacija za KPTN
Genomska lokacija za KPTN
Bend7 A2|7 8.75 cMPočetak16,119,895 bp[2]
Kraj16,127,516 bp[2]
Obrazac RNK ekspresije
PBB GE KPTN 220160 s at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija actin binding
actin filament binding
Ćelijska komponenta projekcija ćelije
actin cytoskeleton
filamentous actin
postsynaptic actin cytoskeleton
stereocilium
KICSTOR complex
Lizozom
lysosomal membrane
membrana
lamellipodium
Biološki proces actin filament organization
cellular response to glucose starvation
protein localization to lysosome
negative regulation of TORC1 signaling
cellular response to amino acid starvation
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001291296
NM_007059

NM_133727

RefSeq (bjelančevina)

NP_001278225
NP_008990

NP_598488

Lokacija (UCSC)Chr 19: 47.48 – 47.48 MbChr 7: 16.12 – 16.13 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Kaptin je protein koji je kod ljudi kodiran genom KPTN.[5][6]

Aminokiselinska sekvenca

Simboli
1020304050
MMGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKV
LGFRYQDLRQKIRPVAKELQFNYIPVDAEIVSIDTFNKSPPKRGLVVGIT
FIKDSGDKGSPFLNIYCDYEPGSEYNLDSIAQSCLNLELQFTPFQLCHAE
VQVGDQLETVFLLSGNDPAIHLYKENEGLHQFEEQPVENLFPELTNLTSS
VLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVLQDGPI
SRVIVFSLSAAKETKDRPLQDEYSVLVASMLEPAVVYRDLLNRGLEDQLL
LPGSDQFDSVLCSLVTDVDLDGRPEVLVATYGQELLCYKYRGPESGLPEA
QHGFHLLWQRSFSSPLLAMAHVDLTGDGLQELAVVSLKGVHILQHSLIQA
SELVLTRLRHQVEQRRRRLQGLEDGAGAGPAENAAS

Model organizmi[uredi | uredi izvor]

Kptn fenotipovi nokaut-miševa
Svojstvo Fenotip
Vijabilnost homozigota Normalna
Plodnost Normalna
Tjelesna težina Nenormalna[7]
Ansioznost na testu otvorenog polja Normalna
Neurološka procjena Normaln
Snaga stiska Normalna
Vruća oloča Normalna
Dusmorphologija Normalna
Indirektna jalorimetrija Normalna
Ttest tolerancije glukoze Nenormalan[8]
Slušni odgovor moždanog debla Normalan
DEXA Nenormalna[9]
Radiografija Normalna
Tjelesna temperatura Normalna
Morfologija oka Normalna
Klinička hemija (nalazi) Nenormalna[10]
Hematologija Normalna
Periferni krvni limfociti Nenormalni[11]
Mikronukleus test Normalan
Težina srca Normalna
Infekcija salmonelom Nenormalna[12]
Infekcija Citrobacter-om Normalna[13]
Svi testovi i podaci sa linka[14][15]

Model-organizmi korišteni su u proučavanju funkcije KPTN-a. Uslovna linija nokaut-miša, zvana Kptn tm1a(EUCOMM)Wtsi[16][17] generirana u okviru programa Međunarodni konzorcij za nokaut-miševe – visokopropusnog projekta mutageneze za generiranje i distribuciju životinjskih modela bolesti zainteresiranim naučnicima.[18][19][20]

Muške i ženske životinje prolazile su standardizirani fenotipski pregled, kako bi se utvrdili efekti delecije.[14][21] Izvedena su 22 testa na mutantnim miševima i uočeno je šest značajnih abnormalnosti.[14] Homozigotni mutirani miševi su imali hiperalbuminemiju, smanjen broj zrelih B-ćelija i povećanu osjetljivosti na bakterijsku infekciju. Ženke su također imale povećanu tjelesnu težinu, tjelesnu masnoću i smanjenu toleranciju glukoze.[14]

Klinički značaj[uredi | uredi izvor]

Mutacije u ovom genu povezane su sa sindromom akrocefalije, mišićne hipotonije, globalnog kašnjenja u razvoju, dispraksije i sinkinezije ruku i usta.[22]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000118162 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000006021 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Bearer EL, Abraham MT (februar 1999). "2E4 (kaptin): a novel actin-associated protein from human blood platelets found in lamellipodia and the tips of the stereocilia of the inner ear". European Journal of Cell Biology. 78 (2): 117–26. doi:10.1016/s0171-9335(99)80013-2. PMC 3376092. PMID 10099934.
  6. ^ "Entrez Gene: KPTN kaptin (actin binding protein)".
  7. ^ "Body weight data for Kptn". Wellcome Trust Sanger Institute.
  8. ^ "Glucose tolerance test data for Kptn". Wellcome Trust Sanger Institute.
  9. ^ "DEXA data for Kptn". Wellcome Trust Sanger Institute.
  10. ^ "Clinical chemistry data for Kptn". Wellcome Trust Sanger Institute.
  11. ^ "Peripheral blood lymphocytes data for Kptn". Wellcome Trust Sanger Institute.
  12. ^ "Salmonella infection data for Kptn". Wellcome Trust Sanger Institute.
  13. ^ "Citrobacter infection data for Kptn". Wellcome Trust Sanger Institute.
  14. ^ a b c d Gerdin AK (2010). "The Sanger Mouse Genetics Programme: High throughput characterisation of knockout mice". Acta Ophthalmologica. 88: 925–7. doi:10.1111/j.1755-3768.2010.4142.x. S2CID 85911512.
  15. ^ Mouse Resources Portal, Wellcome Trust Sanger Institute.
  16. ^ "International Knockout Mouse Consortium".
  17. ^ "Mouse Genome Informatics".
  18. ^ Skarnes WC, Rosen B, West AP, Koutsourakis M, Bushell W, Iyer V, et al. (juni 2011). "A conditional knockout resource for the genome-wide study of mouse gene function". Nature. 474 (7351): 337–42. doi:10.1038/nature10163. PMC 3572410. PMID 21677750.
  19. ^ Dolgin E (juni 2011). "Mouse library set to be knockout". Nature. 474 (7351): 262–3. doi:10.1038/474262a. PMID 21677718.
  20. ^ Collins FS, Rossant J, Wurst W (januar 2007). "A mouse for all reasons". Cell. 128 (1): 9–13. doi:10.1016/j.cell.2006.12.018. PMID 17218247. S2CID 18872015.
  21. ^ van der Weyden L, White JK, Adams DJ, Logan DW (juni 2011). "The mouse genetics toolkit: revealing function and mechanism". Genome Biology. 12 (6): 224. doi:10.1186/gb-2011-12-6-224. PMC 3218837. PMID 21722353.
  22. ^ Lucena PH, Armani-Franceschi G, Bispo-Torres AC, Bandeira ID, Lucena MF, Maldonado I, et al. (2020). "KPTN gene homozygous variant-related syndrome in the northeast of Brazil: A case report". Am J Med Genet A. 182 (4): 762–767. doi:10.1002/ajmg.a.61492. PMID 31999056. S2CID 210945773.

Dopunska literatura[uredi | uredi izvor]