Idi na sadržaj

ZNF687

S Wikipedije, slobodne enciklopedije
ZNF687
Identifikatori
AliasiZNF687
Vanjski ID-jeviOMIM: 610568 MGI: 1925516 HomoloGene: 10827 GeneCards: ZNF687
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za ZNF687
Genomska lokacija za ZNF687
Bend1q21.3Početak151,281,618 bp[1]
Kraj151,292,176 bp[1]
Lokacija gena (miš)
Hromosom 3 (miš)
Hrom.Hromosom 3 (miš)[2]
Hromosom 3 (miš)
Genomska lokacija za ZNF687
Genomska lokacija za ZNF687
Bend3|3 F2.1Početak95,006,590 bp[2]
Kraj95,015,448 bp[2]
Ontologija gena
Molekularna funkcija vezivanje iona metala
vezivanje sa DNK
GO:0001948, GO:0016582 vezivanje za proteine
nucleic acid binding
GO:0001200, GO:0001133, GO:0001201 DNA-binding transcription factor activity, RNA polymerase II-specific
Ćelijska komponenta jedro
citoplazma
nukleoplazma
citosol
Biološki proces GO:0009373 regulation of transcription, DNA-templated
transcription, DNA-templated
GO:0044324, GO:0003256, GO:1901213, GO:0046019, GO:0046020, GO:1900094, GO:0061216, GO:0060994, GO:1902064, GO:0003258, GO:0072212 regulation of transcription by RNA polymerase II
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001304763
NM_001304764
NM_020832

NM_030074
NM_001357863

RefSeq (bjelančevina)

NP_001291692
NP_001291693
NP_065883

NP_084350
NP_001344792

Lokacija (UCSC)Chr 1: 151.28 – 151.29 MbChr 3: 95.01 – 95.02 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Protein cinkovog prsta 687 je cinkov prst koji je kod ljudi kodiran genom ZNF687 sa hromosoma 1.[5][6]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 1 237 aminokiselina, a molekulska težina 129.529 Da.[7]

1020304050
MGDMKTPDFDDLLAAFDIPDIDANEAIHSGPEENEGPGGPGKPEPGVGSE
SEDTAAASAGDGPGVPAQASDHGLPPPDISVVSVIVKNTVCPEQSEALAG
GSAGDGAQAAGVTKEGPVGPHRMQNGFGSPEPSLPGTPHSPAPPSGGTWK
EKGMEGKTPLDLFAHFGPEPGDHSDPLPPSAPSPTREGALTPPPFPSSFE
LAQENGPGMQPPVSSPPLGALKQESCSPHHPQVLAQQGSGSSPKATDIPA
SASPPPVAGVPFFKQSPGHQSPLASPKVPVCQPLKEEDDDEGPVDKSSPG
SPQSPSSGAEAADEDSNDSPASSSSRPLKVRIKTIKTSCGNITRTVTQVP
SDPDPPAPLAEGAFLAEASLLKLSPATPTSEGPKVVSVQLGDGTRLKGTV
LPVATIQNASTAMLMAASVARKAVVLPGGTATSPKMIAKNVLGLVPQALP
KADGRAGLGTGGQKVNGASVVMVQPSKTATGPSTGGGTVISRTQSSLVEA
FNKILNSKNLLPAYRPNLSPPAEAGLALPPTGYRCLECGDAFSLEKSLAR
HYDRRSMRIEVTCNHCARRLVFFNKCSLLLHAREHKDKGLVMQCSHLVMR
PVALDQMVGQPDITPLLPVAVPPVSGPLALPALGKGEGAITSSAITTVAA
EAPVLPLSTEPPAAPATSAYTCFRCLECKEQCRDKAGMAAHFQQLGPPAP
GATSNVCPTCPMMLPNRCSFSAHQRMHKNRPPHVCPECGGNFLQANFQTH
LREACLHVSRRVGYRCPSCSVVFGGVNSIKSHIQTSHCEVFHKCPICPMA
FKSGPSAHAHLYSQHPSFQTQQAKLIYKCAMCDTVFTHKPLLSSHFDQHL
LPQRVSVFKCPSCPLLFAQKRTMLEHLKNTHQSGRLEETAGKGAGGALLT
PKTEPEELAVSQGGAAPATEESSSSSEEEEVPSSPEPPRPAKRPRRELGS
KGLKGGGGGPGGWTCGLCHSWFPERDEYVAHMKKEHGKSVKKFPCRLCER
SFCSAPSLRRHVRVNHEGIKRVYPCRYCTEGKRTFSSRLILEKHVQVRHG
LQLGAQSPGRGTTLARGSSARAQGPGRKRRQSSDSCSEEPDSTTPPAKSP
RGGPGSGGHGPLRYRSSSSTEQSLMMGLRVEDGAQQCLDCGLCFASPGSL
SRHRFISHKKRRGVGKASALGLGDGEEEAPPSRSDPDGGDSPLPASGGPL
TCKVCGKSCDSPLNLKTHFRTHGMAFIRARQGAVGDN

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000143373 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000019338 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Nagase T, Kikuno R, Ishikawa KI, Hirosawa M, Ohara O (Apr 2000). "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro". DNA Res. 7 (1): 65–73. doi:10.1093/dnares/7.1.65. PMID 10718198.
  6. ^ "Entrez Gene: ZNF687 zinc finger protein 687".
  7. ^ "UniProt, Q8N1G0" (jezik: en.). Pristupljeno 8. 12. 2021.CS1 održavanje: nepoznati jezik (link)

Dopunska literatura[uredi | uredi izvor]