ZNF703

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
ZNF703
Identifikatori
AliasiZNF703
Vanjski ID-jeviOMIM: 617045 MGI: 2662729 HomoloGene: 81391 GeneCards: ZNF703
Lokacija gena (čovjek)
Hromosom 8 (čovjek)
Hrom.Hromosom 8 (čovjek)[1]
Hromosom 8 (čovjek)
Genomska lokacija za ZNF703
Genomska lokacija za ZNF703
Bend8p11.23Početak37,695,782 bp[1]
Kraj37,700,019 bp[1]
Lokacija gena (miš)
Hromosom 8 (miš)
Hrom.Hromosom 8 (miš)[2]
Hromosom 8 (miš)
Genomska lokacija za ZNF703
Genomska lokacija za ZNF703
Bend8|8 A2Početak27,467,353 bp[2]
Kraj27,471,489 bp[2]
Ontologija gena
Molekularna funkcija metal ion binding
GO:0001948, GO:0016582 protein binding
nucleic acid binding
Ćelijska komponenta citoplazma
nuclear matrix
Jedro
GO:0009327 protein-containing complex
Biološki proces positive regulation of mammary gland epithelial cell proliferation
GO:0009373 regulation of transcription, DNA-templated
adherens junction assembly
positive regulation of cell migration
regulation of canonical Wnt signaling pathway
cellular response to estradiol stimulus
positive regulation of epithelial to mesenchymal transition
transcription, DNA-templated
mammary gland epithelial cell differentiation
regulation of cell cycle
regulation of transforming growth factor beta receptor signaling pathway
negative regulation of homotypic cell-cell adhesion
positive regulation of cell population proliferation
GO:0045996 negative regulation of transcription, DNA-templated
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_025069

NM_001101502
NM_001110508

RefSeq (bjelančevina)

NP_079345

NP_001094972
NP_001103978

Lokacija (UCSC)Chr 8: 37.7 – 37.7 MbChr 8: 27.47 – 27.47 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš
Protein cinkovog prsta 703
Identifikatori
SimbolZNF703
NCBI gen80139
HGNC25883
RefSeqNM_025069
Ostali podaci
LokusHrom. 8 p12

ZNF703[5] je gen koji je povezan s razvojem raka dojke.[6][7][8] ZNF703 se nalazi u porodici proteina NET/N1z, odgovornoj za regulaciju bitne transkripcije za razvoj organizna, posebno u stražnjem mozgu.[9] Normalne funkcije koje obavlja ZNF703 uključuju adheziju, kretanje i proliferaciju ćelija.[9] ZNF703 direktno akumulira histonske deacetilaze u regijama promotora gena, ali se ne veže za funkcionalnu DNK.[10]

Prema istraživanja naučnika iz Cancer Research UK, bilo je to prvo onkogeno otkriće u posljednjih šest godina.[7]

ZNF703 je dio sekvence 8p12 telomernog amplikona, koji je povezan s rakom dojke Luminal B. Nedavno je ZNF703 identifikovan kao pokretač pojačanja lokusa 8p12.[11]

Pacijenti kojima je dijagnosticiran lumenski karcinom B uzrokovan ZNF703 obično imaju niže stope oporavka i preživljavanja od drugih tipova raka.[12]

Otprnost na lijek ZNF703 pokazana je kada se pacijenti liječe lijekom Tamoxifen protiv raka.[13]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 590 aminokiselina, а molekulska težina 58.222 Da.[14]

1020304050
MSDSPAGSNPRTPESSGSGSGGGGKRPAVPAAVSLLPPADPLRQANRLPI
RVLKMLSAHTGHLLHPEYLQPLSSTPVSPIELDAKKSPLALLAQTCSQIG
KPDPPPSSKLNSVAAAANGLGAEKDPGRSAPGAASAAAALKQLGDSPAED
KSSFKPYSKGSGGGDSRKDSGSSSVSSTSSSSSSSPGDKAGFRVPSAACP
PFPPHGAPVSASSSSSSPGGSRGGSPHHSDCKNGGGVGGGELDKKDQEPK
PSPEPAAVSRGGGGEPGAHGGAESGASGRKSEPPSALVGAGHVAPVSPYK
PGHSVFPLPPSSIGYHGSIVGAYAGYPSQFVPGLDPSKSGLVGGQLSGGL
GLPPGKPPSSSPLTGASPPSFLQGLCRDPYCLGGYHGASHLGGSSCSTCS
AHDPAGPSLKAGGYPLVYPGHPLQPAALSSSAAQAALPGHPLYTYGFMLQ
NEPLPHSCNWVAASGPCDKRFATSEELLSHLRTHTALPGAEKLLAAYPGA
SGLGSAAAAAAAAASCHLHLPPPAAPGSPGSLSLRNPHTLGLSRYHPYGK
SHLSTAGGLAVPSLPTAGPYYSPYALYGQRLASASALGYQ

Otkriće[uredi | uredi izvor]

Karcinogena priroda ZNF703 otkrivena je 2011., tokom istraživanja o klasifikaciji i otpornosti različitih onkogena.[9] Istraživači su pokušali uočiti faktore povezane s različitim tipovima raka, promatranjem onkogenog mehanizma na molekulskoj skali.[9] Lumenski put raka B pokazao je amplifikaciju pet različitih genomskih područja uključujući hromosomsku regiju 8p12.[9] Došlo je do pojačanja regije 8p12 putem transkripcijske regulacije ZNF703.[9]

Lokacija[uredi | uredi izvor]

Onkogenen ZNF703 nalazi se na p kraku ljudskog hromosoma 8, pozicija 8p12.

ZNF703 nalazi se na ljudskom hromosomu 8 u regiji kratkog kraka, koja se obično naziva hromosomska regija 8p12.[6] Tumori generirani sa ZNF703 pokazali su gubitak veličine počevši od telomera i završavajući na 8p12, dok je regija 8p12–11 povećana.[15] Prisutna je fluktuacija između povećanja i smanjenja duž granične hromsomske regije 8p12–8p21.[15] Utvrđen je obrazac koji uključuje tri slične regije poremećenog rasta i četiri regije pojačanog rasta, počevši od telomere i završava na centromeri.[15]

Uloga u kanceru[uredi | uredi izvor]

Gen ZNF703 općenito ima aktivnu ulogu u tumorskim ćelijama lumenskog kancera B koje se nalaze u mliječnim kanalima.[6] Obično je ekspresija ZNF703 veća kada su tumori estrogenih receptora pozitivni, za razliku od negativnih estrogenih receptora.[6] ZNF703 je koekspresprimiran u jedarnom kompleksu koji sadrži gene DCAF7, NCRO2 i PHB2.[6] ZNF703 stvara jedarni protein odgovoran za represiju proteina povezanih s receptorima estrogena. Ekspresija gena iz matičnih ćelija aktivira se kada gen ZNF703 postane nadeksprimiran u kompleksu.[6] Kao posljedica toga, brzo se povećava obilnost i običnih i matičnih ćelija raka.[6] Nadekspresija ZNF703 uzrokuje i razvoj primarnih i sekundarnih tumora, uz pojačanu proizvodnju CD49F-pozitivnih ćelija povezanih s rakom debelog crijeva.[6] ZNF703 također doživljava ciljanu regulaciju ćelija raka putem transkripcije RNK SPRY4-It1.[16] RNK SPRY4-IT1 je nekodirajući gen odgovoran za sprječavanje apoptoza i stvaranje velikih tumora.[16]

Istraživači su nedavno ustanovili vezu između gena okidača ZNF703 i aktivacije putanje Akt/mTOR uključene u ćelijski ciklus, što dovodi do stvaranja tumora pluća.[17]

Prognoza[uredi | uredi izvor]

Životni vijek pogođenih kolorektumskim karcinomom i lumenskim karcinomom ima različite prognoze, ovisno o količini ekspresije gena ZNF703.[12] Niski nivoi transkripcije ZNF703 obično dovode do zdravije prognoze od osoba koje imaju više nivoe transkripcije onkogena.[12] ZNF703 je cilj terapijskih lijekova jer se stopa preživljavanja povećava kako se stopa transkripcije smanjuje.[12]

Otpornost na lijekove[uredi | uredi izvor]

Lijek Tamoxifen je lijek koji se obično daje za liječenje lumenskog karcinoma.[13] Polovina pacijenata liječenih Tamoxifenom otporna je na lijek.[13] Prekomjerna ekspresija ZNF703 povezana je s rezistencijom na Tamoxifen.[13] Kako transkripcija gena ZNF703 dostiže značajne razine, umjesto da blokira proliferaciju ćelija, utvrđeno je da Tamoxifen povećava diobu kancerskih ćelija.[13] Tamoxifen se može davati samo u malim dozama, a pacijenti se svakodnevno prate, kako bi se izbjegao rast tumora.[13]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000183779 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000085795 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Arhivirana kopija". Arhivirano s originala, 17. 10. 2013. Pristupljeno 17. 9. 2021.CS1 održavanje: arhivirana kopija u naslovu (link)
  6. ^ a b c d e f g h Sircoulomb F, Nicolas N, Ferrari A, et al. (februar 2011). "ZNF703 gene amplification at 8p12 specifies luminal B breast cancer". EMBO Molecular Medicine. 3 (3): 153–166. doi:10.1002/emmm.201100121. PMC 3395112. PMID 21328542.
  7. ^ a b "BBC News - Key breast cancer 'driver' gene found". 18. 2. 2011. Pristupljeno 18. 2. 2011.
  8. ^ Kwek SS, Roy R, Zhou H, et al. (april 2009). "Co-amplified genes at 8p12 and 11q13 in breast tumors cooperate with two major pathways in oncogenesis". Oncogene. 28 (17): 1892–903. doi:10.1038/onc.2009.34. PMC 2722962. PMID 19330026.
  9. ^ a b c d e f YANG, GONGLI; MA, FENG; ZHONG, MUXIAO; FANG, LIN; PENG, YAO; XIN, XIAOMING; ZHONG, JIETAO; YUAN, FANGFANG; GU, HONGXIANG (2014). "ZNF703 acts as an oncogene that promotes progression in gastric cancer". Oncology Reports. 31 (4): 1877–1882. doi:10.3892/or.2014.2997. PMID 24481460.
  10. ^ Nakamura, Mako; Choe, Seong-Kyu; Runko, Alexander P.; Gardner, Paul D.; Sagerström, Charles G. (12. 11. 2008). "Nlz1/Znf703 acts as a repressor of transcription". BMC Developmental Biology. 8: 108. doi:10.1186/1471-213x-8-108. ISSN 1471-213X. PMC 2588584. PMID 19014486.
  11. ^ Holland, Daniel (Feb 2011). "ZNF703 is a common Luminal B breast cancer oncogene that differentially regulates luminal and basal progenitors in human mammary epithelium". EMBO Molecular Medicine. 3 (3): 167–80. doi:10.1002/emmm.201100122. PMC 3395113. PMID 21337521.
  12. ^ a b c d MA, FENG; BI, LIHONG; YANG, GONGLI; ZHANG, MENGNAN; LIU, CUIPING; ZHAO, YINGYING; WANG, YADONG; WANG, JIDE; BAI, YANG (2014). "ZNF703 promotes tumor cell proliferation and invasion and predicts poor prognosis in patients with colorectal cancer". Oncology Reports. 32 (3): 1071–1077. doi:10.3892/or.2014.3313. PMID 25017610.
  13. ^ a b c d e f Zhang, Xi; Mu, Xin; Huang, Ou; Xie, Zuoquan; Jiang, Min; Geng, Meiyu; Shen, Kunwei (26. 8. 2013). "Luminal Breast Cancer Cell Lines Overexpressing ZNF703 Are Resistant to Tamoxifen through Activation of Akt/mTOR Signaling". PLOS ONE. 8 (8): e72053. doi:10.1371/journal.pone.0072053. ISSN 1932-6203. PMC 3753350. PMID 23991038.
  14. ^ "UniProt, Q9H7S9" (jezik: engleski). Pristupljeno 17. 9. 2021.
  15. ^ a b c Gelsi-Boyer, Véronique; Orsetti, Béatrice; Cervera, Nathalie; Finetti, Pascal; Sircoulomb, Fabrice; Rougé, Carole; Lasorsa, Laurence; Letessier, Anne; Ginestier, Christophe (1. 12. 2005). "Comprehensive Profiling of 8p11-12 Amplification in Breast Cancer". Molecular Cancer Research. 3 (12): 655–667. doi:10.1158/1541-7786.mcr-05-0128. PMID 16380503.
  16. ^ a b Shi, Yongguo; Li, Juan; Liu, Yangchen; Ding, Jie; Fan, Yingrui; Tian, Yun; Wang, Li; Lian, Yifan; Wang, Keming (22. 2. 2015). "The long noncoding RNA SPRY4-IT1 increases the proliferation of human breast cancer cells by upregulating ZNF703 expression". Molecular Cancer. 14: 51. doi:10.1186/s12943-015-0318-0. ISSN 1476-4598. PMC 4350857. PMID 25742952.
  17. ^ Baykara, Onur; Dalay, Nejat; Kaynak, Kamil; Buyru, Nur (1. 10. 2016). "ZNF703 Overexpression may act as an oncogene in non-small cell lung cancer". Cancer Medicine (jezik: engleski). 5 (10): 2873–2878. doi:10.1002/cam4.847. ISSN 2045-7634. PMC 5083741. PMID 27650486.