CCDC144A

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
CCDC144A
Identifikatori
AliasiCCDC144A
Vanjski ID-jeviHomoloGene: 108248 GeneCards: CCDC144A
Lokacija gena (čovjek)
Hromosom 17 (čovjek)
Hrom.Hromosom 17 (čovjek)[1]
Hromosom 17 (čovjek)
Genomska lokacija za CCDC144A
Genomska lokacija za CCDC144A
Bend17p11.2Početak16,689,537 bp[1]
Kraj16,777,881 bp[1]
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_014695
NM_001382000

n/a

RefSeq (bjelančevina)

NP_055510
NP_001368929

n/a

Lokacija (UCSC)Chr 17: 16.69 – 16.78 Mbn/a
PubMed pretraga[2]n/a
Wikipodaci
Pogledaj/uredi – čovjek

Domen upredene zavojnice sa proteinom 144A je protein koji je kod ljudi kodiran genom CCDC144A.[3] Alijas ovog gena naziva se KIAA0565. Porodica CCDC ima četiri člana : CCDC 144A, 144B, 144C i pretpostavljeni CCDC 144, N-terminalni protein.[4]

Gen[uredi | uredi izvor]

Ovaj gen ima nukleotidnu sekvencu dugu 5140 bp sa 641 aminokiselinom.[5] Nalazi se na kratkom kraku, plus (prednjeg) lanca hromosoma 17, na p11.2.[6][7] Informacijska RNK gena A CCDC144A ima tri alternativne prerađene izoforme zvane A2RUR9-1, A2RUR9-2 i A2RUR9-3, ali još nemaju eksperimentalnu potvrdu.[8]

Protein[uredi | uredi izvor]

Protein kodiran ovim genom poznat je i kao upredena zavojnica, domen koj sadrži protein 144A (CCDC144A). Sastoji se od 641 aminokiseline.[9] Ovaj protein teži 75,8 kDa i ima izoelektričnu tačku od 6,357.[10] Nalazi se blizu jedra,[11] kao rastvorljivi protein sa hidrofobnosti od -1.021842.[12] Ovaj protein je nesekretorni[13] i ima 10 potencijalnih serina i tri potencijalna treonina fosforilacijskih lokacija.[14] Nema tirozinnsko sulfacijska mjesta,[15] ali na ovom proteinu postoji nekoliko potencijalnih mjesta sumoilacije.[16][17] Predviđa se također da se ovaj protein ne miristoilira.[18] i ne sadrži signalni peptid.[19]

Struktura[uredi | uredi izvor]

Dužina polipeptidnog lanca je 1.427 aminokiselina, sa molekulskom težinom od 165.125[20].

Aminokiselinska sekvenca

1020304050
MASWGGEKRGGAEGSPKPAVYATRKTPSVGSQGDQWYLGYPGDQWSSGFP
YSWWKNSVGSESKHGEGALDQPQHDVRLEDLGELHRAARSGDVPGVEHIL
APGDTGVDKRDRKKSIQQLVPEYKEKQTPESLPQNNNPDWHPTNLTLSDE
TCQRSKNLKVDDKCPSVSPSMPENQSATKELGQMNLTEREKMDTGVVLLS
GNDTLHDLCQSQLPENKESKEAEQDSELTSEEEQERLKGCENKQPQKTSQ
EPEMAKDCDREDIPIYPVLPHVQKSEEMWIEQGKLEWKNQLKLVINELKQ
RFGEIYEKYKIPACPEEEPLLDNSTRGTDVKDIPFNLTNNIPGCEEEDAS
EISVSVVFETFPEQKEPSLKNIIHPYYHPYSGSQEHVCQSSSKFHLHENK
LDCDNDNKPGIGHIFSTDKNFHNDASTKKARNPEVVMVEMKEDQEFDLQM
TKNMNQNSDSGSTNNYKSLKPKLENLSSLPPDSDRTSEVYLHEELQQDMQ
KFKNEVNTLEEEFLALKKEDVQLHKDVEEEMEKHRSNSTELSGTLTDGTT
VGNDDDGLNQQIPRKENGEHDRPADKTSNEKNEVKNQIYPEADFADSMEP
SEIASEDCELSHSVYENFMLLIEQLRMEYKDSASLPRIQDTFCLCEHLLK
LKNNHCDQLTVKLKQMENMVSVLQNELSETKKTKLQLELQKIEWEKELYD
LRLALKQENEEKRNADMLYNKDSEQLRIKEEECGKVVETKQQLKWNLRRL
VKELRTVRNNLDLVVQERNDAQKQLSEEQDARILQDQILTSKQKELEMAR
KKMNSEISHRHQKEKDLFHEDCMLQEEIALLRLEIDTIKNQNKQKEKKYF
EDIEAVKEKNDNLQKIIKLNEETLTETILQYSGQLNNLTAENKILNSELE
NGKQNQERLEIEMESYRCRLAAAVRDCDQSQTARDLKLDFQRTRQEWVRL
HDKMKVDMSGLQAKNEILSEKLSNAESKINSLQIQLHNTRDALGRESLIL
ERVQRDLSQTQCQKKETEQMYQIEQSKLKKYIAKQESVEERLSQLQSENM
LLRQQLDDAHKKANSQEKTSSTIQDQFHSAAKNLQAESEKQILSLQEKNK
ELMDEYNHLKERMDQCEKEKAGRKIDLTEAQETVPSRCLHLDAENEVLQL
QQTLFSMKAIQKQCETLQKNKKQLKQEVVNLKSYMERNMLERGKAEWHKL
LIEERARKEIEEKLNEAILTLQKQAAVSHEQLVQLREDNTTSIKTQMELT
IKDLESEISRIKTSQADFNKTELERYKELYLEEVKVRESLSNELSRTNEM
IAEVSTQLTVEKEQTRSRSLFTAYATRPVLESPCVGNLNDSEGLNRKHIP
RKKRSALKDMESYLLKMQQKLQNDLTAEVAGSSQTGLHRIPQCSSFSSSS
LHLLLCSICQPFFLILQLLLNMNLDPI
Simboli

Domeni[uredi | uredi izvor]

Ovaj protein ima domen nepoznate funkcije (DUF) 3496, koji je u eukariota konzerviran.[21] Domen DUF3496 nalazi se iz aminokiselina 547-622.[9] CCDC144A, alias ovog gena, ukazuje na to da unutar proteina treba postojati domen upredena zavojnica. Upredene zavojnice su strukturni motivi u proteinima u kojima su zajedno savijena još dva alfa-heliksa, koji obično sadrže heptadni ponavljač, hxxhcxc ili hidrofobne (h) i aminokiselinske ostatke naboja (c).[7] Neprevedena područja 5'i 3' nukleotidne sekvence ovog gena bogata su strukturama matične petlje.[22] Umjesto upredene zavojnice pronađen je i leucinski zatvarač.[11] Ostaci 478-499, "LHNTRDALGRESLILERVQRDL", su oni koji čine obrazac patentnog leucinskog zatvarača .[11] Struktura ovog proteina sastoji se uglavnom od alfa-heliksa, sa nekim slučajnim zavojnicama.[23]

Evolucija[uredi | uredi izvor]

Broj Vrsta
1 Devetoprugasti armadilo
2 Goveče
3 Ledteća lisica
4 Mišouhi šišmiš
5 Čimpanza
6 Verirovka
7 Kućni miš
8 Kineski hrčak
9 Goli krtičasti pacov
10 Rezus majmun
11 Rakojedi makak
12 Ljudski KIAA0565
13 Kljunar
14 Zašpadna ksndžasta žaba
15 Riba pufer
16 Karolinska anola
17 Zebrasta zeba

Ortolozi proteina KIAA0565 identificirani su uglavnom kod sisara, ali i nekih ptica, gmizavaca, vodozemaca i riba.[24]

Potencijalni ortolozi[uredi | uredi izvor]

Protein Rod i vrsta Uobičajeno imeCommon name Ortologni prostor Naslovni upit (%) Maksimalni identitet (%) Pristupni broj
CCDC 144A Macaca fasicularis Rakojedi makak 0 97 86 EHH57800.1[9]
CCDC 144A, parcijalni Macaca mulatta Rezus majmun 0 97 86 EHH24608.1[9]
ANKRD 26 Pan troglodytes Obični čumpanza 2e-160 96 67 JAA07196.1[9]
ANKRD 26, pretpostavljeni Dasypus novemcinctus Devetoprugi armadilo 1e-158 96 65 XP_004470808.1[9]
ANKRD 26 Myotis davidii Mišouhi šišmiš 2e-154 96 64 ELK35935.1[9]
ANKRD 26 Bos taurus Goveče 2e-157 96 63 NP_001107239.1[9]
ANKRD 26 Tupaia chinensis Verirovka 3e-147 96 62 ELW73004.1[9]
ANKRD 26 Cricetulus griseus Kineski hrčak 1e-145 96 60 EGW08323.1[9]
ANKRD 26 Heterocephalus glaber Goli krtičasti pacov 2e-138 96 59 EHB01988.1[9]
ANKRD 26 Mus musculus Kujćni miš 4e-141 96 57 NP_001074581.1[9]
ANKRD 26, parcijalni Pteropus alecto Crna leteća lisica 2e-171 97 51 ELK03279.1[9]
ANKRD 26-oliki, pretpostaljeni Ornithorhynchus anatinus Kljunar 2e-108 96 51 XP_001509663.2[9]
ANKRD 26-oliki, pretpostaljeni Taeniopygia guttata Zebrasta zeba 3e-88 92 45 XP_004177264.1[9]
ANKRD 26-oliki, pretpostaljeni Anolis carolinensis Karolinska anola 2e-75 97 44 XP_003221333.1[9]
ANKRD 26, pretpostaljeni Xenopus tropicalis Zapadna kandžasta žaba 2e-78 98 44 XP_002935004.1[9]
Neimenovani preoteinski proizvod Tetraodon nigroviridis Riba pufer 1e-28 98 34 CAF98417.1[9]

[24]

Klinički značaj[uredi | uredi izvor]

Ovaj gen povezan je sa Smith-Magenisovim sindromom (SMS), koji je poznat i kao delecijski sindrom hromosoma 17p11.2,[25] sindrom delecije hromosoma 17p ,[26] sindrom delecije 17p,[26] parcijalna monosomija 17p[26] i delecijska abnormalnost.[27][28]

Interaktivni proteini[uredi | uredi izvor]

Potencijalno mogu postojati dva proteina koja djeluju u interakciji s KIAA0565, a to su ubikvitin specifična peptidaza 32 (USP32) i ubikvitin specifična peptidaza 25 (USP25).[29]

Ekspresija[uredi | uredi izvor]

Pokazalo se da ovaj protein ima relativno nisku ekspresiju u svim tkivima.[30]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000170160 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ "NCBI: Gene".
  4. ^ "NeXtProt".
  5. ^ "NCBI".
  6. ^ "NCBI: Gene".
  7. ^ a b "GeneCards".
  8. ^ "GenBank: The Human Gene Compendium".
  9. ^ a b c d e f g h i j k l m n o p q r "NCBI: Protein".
  10. ^ a b "Biology Workbench".[trajno mrtav link]
  11. ^ a b c "PSORTII".
  12. ^ "SOSUI Hydrophobicity". Arhivirano s originala, 18. 3. 2004. Pristupljeno 11. 5. 2013.
  13. ^ "ExPASy: SignalP".
  14. ^ "ExPASy: NetPhos".
  15. ^ "ExPASy: Sulfinator".
  16. ^ "ExPASy: SUMOplot".
  17. ^ "ExPASy: SUMOsp".
  18. ^ "ExPASy: Myristoylator".
  19. ^ "ExPASy: NetNGlyc".
  20. ^ "UniProt, A2RUR9". Pristupljeno 12. 9. 2017.
  21. ^ "The European Bioinformatics Institute".
  22. ^ "MFOLD".
  23. ^ "PELE: Biology Workbench".
  24. ^ a b "BLASTp".
  25. ^ "NIH Rare Diseases".
  26. ^ a b c "Genetics Home Reference".
  27. ^ "Unified Medical Language System".
  28. ^ "MalaCards".
  29. ^ "Search Tool for the Retrieval of Interacting Genes/Proteins".
  30. ^ "GEO Profiles".

Vanjski linkovi[uredi | uredi izvor]